KEGG   Felis catus (domestic cat): 101081396Help
Entry
101081396         CDS       T02385                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101081396 (MAPK11)
   04010 MAPK signaling pathway
    101081396 (MAPK11)
   04370 VEGF signaling pathway
    101081396 (MAPK11)
   04668 TNF signaling pathway
    101081396 (MAPK11)
   04068 FoxO signaling pathway
    101081396 (MAPK11)
   04071 Sphingolipid signaling pathway
    101081396 (MAPK11)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    101081396 (MAPK11)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101081396 (MAPK11)
   04620 Toll-like receptor signaling pathway
    101081396 (MAPK11)
   04621 NOD-like receptor signaling pathway
    101081396 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    101081396 (MAPK11)
   04660 T cell receptor signaling pathway
    101081396 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    101081396 (MAPK11)
   04670 Leukocyte transendothelial migration
    101081396 (MAPK11)
  Endocrine system
   04912 GnRH signaling pathway
    101081396 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    101081396 (MAPK11)
   04917 Prolactin signaling pathway
    101081396 (MAPK11)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101081396 (MAPK11)
  Nervous system
   04728 Dopaminergic synapse
    101081396 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    101081396 (MAPK11)
   04722 Neurotrophin signaling pathway
    101081396 (MAPK11)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101081396 (MAPK11)
  Development
   04380 Osteoclast differentiation
    101081396 (MAPK11)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101081396 (MAPK11)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101081396 (MAPK11)
  Infectious diseases
   05132 Salmonella infection
    101081396 (MAPK11)
   05133 Pertussis
    101081396 (MAPK11)
   05152 Tuberculosis
    101081396 (MAPK11)
   05164 Influenza A
    101081396 (MAPK11)
   05160 Hepatitis C
    101081396 (MAPK11)
   05169 Epstein-Barr virus infection
    101081396 (MAPK11)
   05145 Toxoplasmosis
    101081396 (MAPK11)
   05140 Leishmaniasis
    101081396 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    101081396 (MAPK11)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101081396 (MAPK11)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101081396 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
B4
AA seq 367 aa AA seqDB search
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLRPVGSGAYGSVCSAYDTRLRQKVAVKKLSR
PFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIV
KCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE
EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIME
VVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRV
SAAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQSP
GSLDIEQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccgccgcccgcccgcaagggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccaggacctgcgcccggtgggctcgggcgcctacggctcg
gtctgctcggcctacgacacgcggctgcgccagaaggtggcagtgaagaagctgtcgcga
cccttccagtcgctgatccacgcgcggaggacctaccgcgagctgcggctgctcaaacac
ctgaagcacgagaacgtcatcgggctgctggacgtgttcacgccggccacctccattgag
gacttcagcgaagtgtacctggtgaccaccctgatgggcgccgacctgaacaacatcgtc
aagtgccaggcgctgagcgacgagcacgtccagttcctggtttaccagctgctgcgcggg
ctcaagtacatccactccgcggggatcatccaccgggacctgaagcccagcaacgtggct
gtgaacgaggactgtgagcttaggatcctggactttgggctagcccgccaggctgatgag
gagatgaccggctatgtggccacccgctggtaccgcgcgcctgagatcatgctcaactgg
atgcactacaaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctc
cagggaaaggccctcttcccaggaaatgactacatcgaccagctgaagcgaatcatggag
gtggtgggcacgcccagccctgaggttctagcaaaaatatcatcggaacacgcccggaca
tacatccagtccctgccccccatgccccagaaggacctcaggagcatcttccgtggagcc
aaccccctggctgtggatctcctgggaaggatgctggtgctggacagtgaccagagggtc
agtgcggctgaggccctggcccatgcctacttcagccagtaccacgaccccgacgatgag
cccgaggctgagccctatgatgaaagcgttgaggccaaggagcggaccgtggaggagtgg
aaggagctcacctaccaggaggtcctcagcttcaagcccccagagccaccgcagtcacct
ggcagcctggatattgagcagtga

DBGET integrated database retrieval system