KEGG   Felis catus (domestic cat): 101081668Help
Entry
101081668         CDS       T02385                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101081668 (PTPN5)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101081668 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D1
AA seq 563 aa AA seqDB search
MNYEEARREREKHPADDSEGGALDMCCSEKLPGHPQPVVMEALDQAEGLADSPREMPPPP
PPSQPSEPAQKPPPRGVGSHSLPVRNSLCLLAASQFLLACGVLWLSGYGPIWSQNATDLI
SSLLTLPEQLGPMAWLGIGTWEVPNLLLVTLSVILITTLVWHLLRAPPEPPAPPRPEDRR
QSVSRQPSFTYSEWMEEKVEDDFLDLDPVPETPVFDFVMDIKPEADPASLTVKSMGLQER
RGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAKELHEKALDPFLLQA
EFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGY
GGEEKVYIATQGPIVSTVSDFWRMVWQEQTPIIVMITNIEEMNEKCTEYWPEEQVMYDGV
EITVQKVIHTEDYRLRLISLRSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAA
RQEGPRCAPIVVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTC
EQYQFVHHVMSLYEKQLSRQSPE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgaggaagccaggagagagagagagaagcaccctgctgatgactccgaggga
ggggccctggacatgtgctgcagcgagaagctgccgggtcacccccagccggtagtgatg
gaggcgctggaccaggccgaagggctcgcggactctccgagagaaatgccaccgccccca
ccgccttcacagccctcagagccagctcagaagccaccacctcgaggcgtcgggagccac
tccctccctgtcaggaacagcctgtgcctgttggccgcctcccagttcctgcttgcctgc
ggggtgctctggctcagcggctatggccccatctggtcacagaatgccacagacctcatc
tcctccttgctcacactcccggaacagctgggacccatggcctggctgggcattgggacc
tgggaagtccccaatctgctgctggttactctgtctgtgatcctcattaccaccctggtg
tggcacctcctgagggctcccccagagccacctgccccaccgcgccctgaggatagacgc
cagtccgtgagccgccagccttccttcacctactccgagtggatggaagagaaggtcgag
gatgacttcctagacctggaccctgtccctgagactcctgtgtttgacttcgtgatggac
atcaagccagaggccgacccggcctcactcaccgtcaagtccatgggtctacaggaaagg
aggggctccaatgtctccctgaccctggacatgtgcacaccaggctgcaatgaggagggc
ttcggctatctcatgtccccacgtgaggagtcagcccgcgagtacctgctcagcgcctcc
cgtgtcctgcaggccaaggagcttcacgagaaggccctggaccccttcctgctgcaggca
gaattctttgaaatccccatgaactttgtggatccgaaggagtatgacatccctgggctg
gtgcggaagaaccggtacaaaaccatccttcccaacccccacagcagagtatgtctgacc
tcgccagaccccgatgaccctctgagttcctacatcaacgccaactacatccggggctac
ggtggggaggagaaggtgtacattgccacgcagggacccatcgtcagcacggtcagcgac
ttctggcgcatggtgtggcaggagcagacacccatcatcgtcatgatcaccaacatcgag
gagatgaatgagaagtgcactgagtattggccggaggagcaggtgatgtacgacggagtg
gagatcactgtgcagaaagtcattcataccgaggattaccggctgcgactcatctccctc
aggagcgggaccgaagagcgaggcctgaagcattactggttcacgtcctggcccgaccag
aagaccccagaccgggcccccccactcctgcacctggtgcgggaggtggaggaggccgcc
cggcaggaggggccccgctgcgcccccatcgtcgtccactgcagtgcagggattgggagg
acgggctgcttcatcgccaccagcatctgctgccagcagctgcggcaggagggagtggtg
gacatccttaagaccacgtgccagctccgtcaggacaggggcggcatgatccagacatgt
gagcaataccagtttgtacaccatgtcatgagcctctacgagaagcagctgtcacgccag
tccccagagtga

DBGET integrated database retrieval system