KEGG   Felis catus (domestic cat): 101081699Help
Entry
101081699         CDS       T02385                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101081699 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101081699 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    101081699 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101081699 (MOS)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101081699 (MOS)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: Other group
  MOS family
   101081699 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
F2
AA seq 348 aa AA seqDB search
MPSPLPRRGYLPGEFSPPVDSRPCSSPAELPGRAGKLLVGGTPPRAPRLPRRLAWCSIDW
EQVRFLQRLGAGGFGSVYKATYHGVPVAIKQVNRCTKNRRASQRSFWAELNIARLRHDNI
VRVVAASTRTPAGFNSLGTIIMEFGGDVTLHQVIYGAPSCPEEDAEPRCCAREQFNLGKC
LKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKIGDFGCSEKLEDLPCCRTPPYP
PGGTYTHRAPELLKGEAVTPKADIYSFAITLWQMSTKEAPYSGERQYVLYAVVAYDLRPS
LSAAVFTDSVSGKRLGKIIQCCWRASALQRPSAELLLVDLNSLRAEFG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgccgcttccccggcgcggttacctccccggcgagttttcgcccccggtggac
tcgaggccctgcagcagccctgctgagctgccaggtagggcagggaagctcctcgtgggt
ggcactcctcccagggccccgcggctaccgcgccggctggcctggtgctccattgactgg
gagcaggtgcgcttcctgcagaggctgggagctggcgggtttggctcggtgtacaaggcc
acctaccacggtgttccggtggccataaagcaagtgaacaggtgcaccaagaaccgacgg
gcgtcccagcgcagcttctgggccgagctcaacatcgccaggcttcgccacgacaacatc
gtgcgggtggtggccgccagcacgcgcacgcccgcaggctttaacagcctgggcaccatc
atcatggagttcggtggcgatgtcaccttacaccaagtcatatacggtgcccccagctgc
cctgaggaggacgcggagcctcgctgctgtgccagagagcaattcaatttgggaaagtgt
ctgaagtattccctagatgtcgtgaacggcctgcttttccttcactcgcaaagcatcgta
cacttggacctgaagcctgcgaacattctgatcagtgagcaggacgtctgcaaaatcggc
gacttcggttgctccgagaagctggaagatctgccctgctgccgcactcccccttacccc
ccggggggcacctacacccaccgagccccagagctcctgaaaggagaggccgtaacgccc
aaagctgacatctattcctttgccatcactctctggcaaatgagtaccaaggaggccccg
tactcaggggagcggcagtacgtgctctacgctgtggtggcctacgatcttcgcccgtct
ctgtcagcagctgtcttcacggactccgtgtctgggaaaagactggggaagatcatccag
tgctgctggagggccagtgccttgcagcggccaagtgcagaactcctcctggtcgacctt
aactccttaagagctgaatttggctga

DBGET integrated database retrieval system