KEGG   Felis catus (domestic cat): 101081699Help
Entry
101081699         CDS       T02385                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:fca04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:fca04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:fca04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:fca04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F2
AA seq 348 aa AA seqDB search
MPSPLPRRGYLPGEFSPPVDSRPCSSPAELPGRAGKLLVGGTPPRAPRLPRRLAWCSIDW
EQVRFLQRLGAGGFGSVYKATYHGVPVAIKQVNRCTKNRRASQRSFWAELNIARLRHDNI
VRVVAASTRTPAGFNSLGTIIMEFGGDVTLHQVIYGAPSCPEEDAEPRCCAREQFNLGKC
LKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKIGDFGCSEKLEDLPCCRTPPYP
PGGTYTHRAPELLKGEAVTPKADIYSFAITLWQMSTKEAPYSGERQYVLYAVVAYDLRPS
LSAAVFTDSVSGKRLGKIIQCCWRASALQRPSAELLLVDLNSLRAEFG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgccgcttccccggcgcggttacctccccggcgagttttcgcccccggtggac
tcgaggccctgcagcagccctgctgagctgccaggtagggcagggaagctcctcgtgggt
ggcactcctcccagggccccgcggctaccgcgccggctggcctggtgctccattgactgg
gagcaggtgcgcttcctgcagaggctgggagctggcgggtttggctcggtgtacaaggcc
acctaccacggtgttccggtggccataaagcaagtgaacaggtgcaccaagaaccgacgg
gcgtcccagcgcagcttctgggccgagctcaacatcgccaggcttcgccacgacaacatc
gtgcgggtggtggccgccagcacgcgcacgcccgcaggctttaacagcctgggcaccatc
atcatggagttcggtggcgatgtcaccttacaccaagtcatatacggtgcccccagctgc
cctgaggaggacgcggagcctcgctgctgtgccagagagcaattcaatttgggaaagtgt
ctgaagtattccctagatgtcgtgaacggcctgcttttccttcactcgcaaagcatcgta
cacttggacctgaagcctgcgaacattctgatcagtgagcaggacgtctgcaaaatcggc
gacttcggttgctccgagaagctggaagatctgccctgctgccgcactcccccttacccc
ccggggggcacctacacccaccgagccccagagctcctgaaaggagaggccgtaacgccc
aaagctgacatctattcctttgccatcactctctggcaaatgagtaccaaggaggccccg
tactcaggggagcggcagtacgtgctctacgctgtggtggcctacgatcttcgcccgtct
ctgtcagcagctgtcttcacggactccgtgtctgggaaaagactggggaagatcatccag
tgctgctggagggccagtgccttgcagcggccaagtgcagaactcctcctggtcgacctt
aactccttaagagctgaatttggctga

DBGET integrated database retrieval system