KEGG   Felis catus (domestic cat): 101081732Help
Entry
101081732         CDS       T02385                                 

Gene name
PCMT1
Definition
(RefSeq) protein-L-isoaspartate (D-aspartate) O-methyltransferase
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     101081732 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
B2
AA seq 217 aa AA seqDB search
MFASFVSENGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALEL
LFDQLHEGAKALDVGSGSGILTACFARMVGSTGKVIGIDHIKELVDDSINNVRKDDPMLL
SSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQM
LEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWARDEL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcctcattcgtttcagaaaatggaatcatcaaaacagataaagtgtttgaagta
atgctggccacagaccgctcccactatgcaaaatgtaacccttatatggattctccacaa
tcaataggtttccaagcaacaatcagtgctccacatatgcatgcatatgcactagaactt
ctatttgatcaattacatgaaggagctaaagctcttgatgtaggatctggaagtggaatc
cttactgcatgttttgcacgtatggttggatctaccggaaaagtcatcggaattgaccac
attaaagagctagtagacgactcaataaataatgtcagaaaggatgatccgatgcttttg
tcttcagggagagtgcagctggttgtgggagatggaagaatgggatatgccgaagaagcc
ccttacgatgctattcatgtaggagctgcagccccagttgtgccccaggcactgatagac
cagttaaagcctggtgggaggttgatactgccagtcggccccgcaggtggcaaccagatg
ctggagcagtacgacaagctgcaggacggcagtgtcaagatgaagcccctgatgggagtg
atctacgtgcctttaacagataaagagaagcagtgggccagggacgaactgtaa

DBGET integrated database retrieval system