KEGG   Felis catus (domestic cat): 101081824Help
Entry
101081824         CDS       T02385                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
fca  Felis catus (domestic cat)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101081824 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101081824 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101081824 (HIBCH)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     101081824 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
C1
AA seq 386 aa AA seqDB search
MGLPEMWSFMCRFNSFKRTNIILQHLRRSMHMDAAGEVLLERRGCAGVITLNRPKFLNAL
NLNMIRHIYPQLKNWEQDPETFLIIIKGAGGKAFCSGGDIRVISEAGRANQKIAQDFFRE
EYRLNNAIGSCQKPYVALIHGITMGGGVGVSVHGQFRVATEKSLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYAAGIATHFVDSEKLGMLEEDLIALKSPSKENI
ADVLEAYHTKSKIDQDKSFILEEHMDKINSCFSANTVEQIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLIMEYRLSQACMGGHDFHEGVRAVLIDKDQSPKWK
PANLKEVTEEDLNSYFKSLASNDLKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggctgccagagatgtggagcttcatgtgcaggtttaattcattcaaaaggacgaat
atcatactgcaacatttgagaaggtctatgcacatggatgcagcaggagaagtactactg
gaaagaagaggttgtgcaggagtgataacactaaacagaccaaagttcctaaatgcatta
aaccttaatatgattcggcacatttatccacaactaaagaattgggaacaagatcctgaa
actttcctgatcattataaaaggagctggtggaaaggctttctgttctgggggtgatatc
agagtgatctcagaagctggaagggcaaaccagaagatagctcaagatttctttagagaa
gaatataggctgaacaatgccattggttcttgccagaaaccatatgttgcacttattcat
ggaattacaatgggtgggggagttggtgtctcagttcatgggcaattccgagtggctact
gagaagtctctctttgcaatgccagaaacagcaatcggactcttccctgatgtgggtgga
ggttatttcttgccacgacttcaaggaaaacttggttacttccttgcattaacaggattc
agactgaaaggaagagatgtgtatgcagcaggaattgcgacacattttgtggattctgaa
aagttgggcatgttagaagaagatttgatagccctaaaatcaccttcaaaagaaaatatt
gcggatgtcttagaagcttaccatacaaagtccaagattgatcaagacaagtcttttata
cttgaggaacacatggacaaaataaacagttgcttctcagccaatactgtggaacagatt
attgaaaatttacagcaagatggttcatcttttgccttagaacagttgaaggtaattaat
aaaatgtctccaacatccctaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgcaagaagtattaattatggaatatcggctgagtcaagcttgtatgggaggccat
gactttcatgaaggtgttagggcagttttaatagataaagaccagagcccaaaatggaaa
ccggctaatctaaaagaagttactgaagaagatttgaatagttactttaaatctctggca
agtaacgatttgaaattataa

DBGET integrated database retrieval system