KEGG   Felis catus (domestic cat): 101081876Help
Entry
101081876         CDS       T02385                                 

Gene name
HDAC11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
fca05034  Alcoholism
fca05165  Human papillomavirus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101081876 (HDAC11)
  Substance dependence
   05034 Alcoholism
    101081876 (HDAC11)
  Infectious diseases
   05165 Human papillomavirus infection
    101081876 (HDAC11)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101081876 (HDAC11)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     101081876 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101081876
NCBI-ProteinID: XP_023105827
Ensembl: ENSFCAG00000007506
Position
A2
AA seq 347 aa AA seqDB search
MPHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVISFLKEEKLLSDGML
VEAREASDEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLKPLRTQTGG
TIMAGKLAMERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIVDL
DAHQGNGHERDFMGDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NLQKALQEHLPDVVVYNAGTDILEGDRLGGLSISPQGIVKRDELVFRVVRGRQVPILMVT
SGGYQKRTARIIADSILNLYSLGLIGSESPSVSAQNSDTPLLPPEVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccacacacaactcagctgtaccagcatgtgccggagacacgctggcccatcgtgtat
tcaccacgctacaacataaccttcatgggcctggagaaactgcacccctttgatgcggga
aaatggggcaaggtgatcagcttcctgaaagaagagaagcttctgtcagatggcatgctg
gtggaggcacgggaggcttcggacgaggatctgctggtggtgcacacgagacgctatctc
aacgagctcaagtggtcctttgctgttgccaccatcacagagatcccccctgtcatcttt
ctccccaacttccttgtgcagaggaaggtgctgaagccccttcggacccagacgggagga
accatcatggcagggaagctggccatggagcgaggctgggccatcaatgtgggtggaggc
ttccaccactgctccagtgaccggggcggaggcttctgtgcctacgcggacatcacactg
gccatcaagtttctgtttgagcgagtggagggcatctccagagccaccatcgttgatctc
gatgcccatcagggcaatgggcatgaacgggacttcatgggtgacaagcgcgtgtacatc
atggatgtgtataaccgccatatctaccccggggaccgcttcgccaaacaggccatcagg
cggaaggtggagctggagtggggcacggaggacgacgagtacctggataaagtggagagg
aacctccagaaagccctccaggagcacctgccggacgtggtcgtgtacaacgcaggcacc
gacatccttgagggcgaccgccttggggggctgtccatcagcccccagggcatcgtgaag
cgggacgaactggtgtttcgggtggtccgcggccgccaggtgcccatcctcatggtgacc
tcgggcggataccagaagcgcacggcccgcatcattgccgactccatccttaatttgtac
agcctggggctcattgggtctgagtcccccagcgtctcggcacagaactcggacacccct
ctgctgcctcccgaggtgccctga

DBGET integrated database retrieval system