KEGG   Felis catus (domestic cat): 101082047Help
Entry
101082047         CDS       T02385                                 

Gene name
LAMB2
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
fca  Felis catus (domestic cat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101082047 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101082047 (LAMB2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101082047 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101082047 (LAMB2)
   05222 Small cell lung cancer
    101082047 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    101082047 (LAMB2)
   05145 Toxoplasmosis
    101082047 (LAMB2)
Cell adhesion molecules and their ligands [BR:fca04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      101082047 (LAMB2)
   VLA-6
      101082047 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A2
AA seq 1801 aa AA seqDB search
MERASWVSGRDLRGLPGPWELRLGLLLSALATALAQALAPDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPG
APVHAEGMVHGACICKHNTRGLNCERCQDFYHDLPWRPAEDGHSHACRKCECHGHAHSCH
FDMAIYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGS
QDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSASDPAGCRRCQCDARGT
VPGITSCDPNSGTCFCKRLVTGRGCNRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCNEA
TGQCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGGTVSWTGR
GFVRLQEGQALEFLVTSVPRAMDYDLLLRLEPQVPEQWAEMEVAVQRPGPVSAHGPCGHM
LPKDDHIPGTLQPETRYMVFPRPVCLEPGISYKLHLKLVRTGGSAQPEAPYSRPSLLIDS
LVLLPRVLVLEMFSGGDAAALERRATFEHYRCHEEGLVPSKTLPSEACVPLLISLSALLY
NGALPCQCDPQGSLSSECNPHGGQCLCKPAVVGRRCDRCAPGFYGFGPTGCQACQCSPEG
ALSGLCEGTSGQCPCRAGAFGLRCDRCQRGQWGFPNCQPCVCNGHADECDTHTGTCLGCR
DHTGGEHCERCIAGFHGDPRLPHGGQCRPCPCPEGPGSRRHFATSCHRDGYSQQIMCHCK
AGYTGLRCEACAPGHFGDPSRPGGQCQPCECSGNIDPTDPDACDPRTGQCLRCLYHTEGP
HCAHCKPGFHGQATRQSCHRCTCNLLGTDPQQCPSTDRCHCDPSSGQCPCLPNVQGPSCD
RCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHTCFGDW
DRVVQDLAARTRRLEQRAQELQQTGVLGAFESRFWHMQEKLGTVQGIVGTRNTSAASTAQ
LVEATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSSLERDGLALNLTLRQLDQH
LDLLKHSNFLGAYDSIRHAHSLSAEAERRANTSALTVPSPVSNSADTRHRTEVLIGAKKE
DFNRKHMANQQALGELSARTQSLSLTGINELVCGPPGDAPCATSPCGGAGCLDEDGQPRC
GGLSCNGAVAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQRAQAALDK
ANASRGQVEKANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAG
AIAERVQSLADVDTILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRA
QGAAQGAIQGAVVDTQDTERTLHQVQEKMAGAEQALSSAGERAQQLDGLLEALKLKRAGN
SLAASSAEETAGSAQGRAREAEQLLQGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDE
ARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTC
Q
NT seq 5406 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggcctcatgggtatcagggagggacctgcggggactgcctgggccctgggag
cttcgactgggcctgctgctgagtgcgctggccaccgccctggcccaggccctggcccca
gatgtgccaggctgttcgaggggaagctgctaccccgccacaggtgacctgctagtgggc
cgtgctgacagactgactgcctcatccacctgtggcttgcatggcccccagccctactgc
atcgttagtcaccttcaggatgagaagaagtgcttcctgtgtgattcccggcgccccttc
tctgctagagacaacccaaacagtcatcgcatccagaatgtagttaccagctttgcacca
cagcgccggacagcctggtggcagtcagagaatggtgtccccgtggtcaccatccagctg
gacttggaggctgagtttcatttcacacacctcattatgaccttcaagacatttcgtcct
gctgccatgctggtggagcgctcagcagactttggacgcacctggcatgtgtaccgatat
ttttcctatgactgtggggctgactttccaggagtcccactggcccccccacggcactgg
gatgacgtagtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtc
atctatcgtgtgctggatcctgccatccctatcccagacccctacagcccacggatccag
aacctgctgaagatcactaacctacgggtgaacctgacacggctgcatacactgggggac
aacctgcttgacccacgacgggagatccgtgagaaatactattatgccctctacgagctg
gttgtgcgtggcaactgcttctgttacggacacgcctcacagtgtgcacccgccccagga
gcaccagtgcatgctgagggcatggttcatggggcctgcatctgcaaacataacactcgt
ggcctcaactgtgagcggtgtcaagatttctatcatgacctgccctggcgtccggctgaa
gatggccacagtcatgcctgcaggaagtgtgagtgccatgggcatgcccacagctgccac
ttcgacatggccatatatctggcatctggcaacgtaagtggaggtgtgtgtgatggatgt
cagcacaacacagctgggcgccactgtgagctctgccgacccttcttctaccgtgaccca
accaaggacctgcgggaccctgctgtgtgccgctcctgtgattgtgaccccatgggttct
caagatggtggtcgctgtgatccccatgatgatcctgctctggggctggtctcgggccag
tgtcgctgcaaagaacatgtggtgggctctcgctgccagcaatgccgtgatggcttcttt
gggctcagtgccagcgaccctgcaggctgtcggcgatgtcagtgtgatgcacggggcaca
gtgcctgggatcacctcttgtgaccccaacagtggaacctgtttctgcaagcgtctagtg
actggacgtggctgcaaccgctgcttgcctggccattggggcctgagccacgacctgctt
ggctgccgtccatgtgattgcgacgtgggtggtgccttggatccccagtgcaatgaggcc
acaggtcagtgccgctgtcgccagcacatggtggggcgacgctgtgagcaggtgcagcct
ggctacttccggcctttccttgaccacctaacttgggaggctgaggacacccgaggacag
gtgctggatgtggtggagcgcctggtgacccctggtgggactgtatcctggacaggccgg
ggctttgttagactgcaggaaggtcaggcactggagttcctggtgacatctgtgccaaga
gccatggattatgatctgctgctgcgcttggagccccaggtccctgagcaatgggcagag
atggaagtggctgtgcagcgcccagggcctgtgtctgcccatggcccgtgtgggcacatg
ctgcccaaggatgaccacattccagggactctgcaaccagaaactaggtatatggtattt
ccaagacctgtctgccttgagcctggcatctcctataagctgcatctgaagctggtgcgg
acagggggaagtgcccagcctgaggccccctactctagacccagcctgctcattgactcg
ttggtgctgcttccccgtgtcctcgtgctggagatgtttagtgggggtgatgctgctgcc
ctggagcgccgtgccacctttgaacactaccgttgtcacgaggagggtctggtgcccagt
aagacccttccctctgaggcctgtgtccccctcctcatcagcctgtctgccctactctac
aatggtgccttgccctgtcagtgtgacccccagggctcactgagttctgagtgtaatccc
catggcggtcagtgcctgtgtaaacctgcagtggttgggcgccgctgtgatcgctgtgcc
cctggtttctacggctttggccccacaggttgtcaagcctgccagtgcagccccgagggg
gcactcagtggcctatgtgaagggaccagtgggcaatgcccctgccgagctggtgccttt
gggcttcgctgcgatcgctgccagcgtggccagtggggattccctaactgccagccatgt
gtctgcaatgggcatgcagatgaatgcgacacccacacaggcacttgcctgggctgccgt
gatcacacagggggtgagcactgtgaaaggtgcattgctggcttccacggggacccacgg
ctaccacatgggggccagtgccggccctgtccctgccctgaaggccctgggagccggcgg
cactttgctacttcttgccatcgggatgggtactcccagcagatcatgtgccactgtaag
gcaggctacacagggctgcggtgcgaagcttgtgcccctgggcactttggggacccatca
aggccaggtggccagtgccagccctgtgagtgcagtgggaacattgaccccacggaccct
gatgcctgtgacccccgcacggggcaatgcctgcgctgcttataccacacggaggggcca
cactgtgcccactgcaagcctggcttccatggacaggccacccgacagagctgtcaccgc
tgcacctgcaacttgctgggcacagatccccagcagtgcccgtccactgaccggtgccac
tgtgacccaagcagtgggcagtgcccatgcctccccaatgtccagggccctagctgtgac
cgctgtgcccccaacttctggaaccttaccagtggccatggatgtcagccctgtgcctgc
cacccaagccgagccagaggccctacctgcaatgagttcacagggcagtgccactgccgt
gctggctttggtgggcgaacctgttctgagtgccaggagctccactggggagaccctggt
ttgcagtgccgcgcctgtgattgtgaccctcgtggaatagacacacctcagtgtcaccgc
tccacgggccactgtagctgccgcccaggcgtgtctggcgtgcgctgtgaccagtgtgcc
cgtggcttctcaggggtctttcctgcttgccacccatgccacacatgcttcggggactgg
gaccgtgtggtacaggacttggctgcccgtacgcggcgcctggagcagcgggcacaggag
ctgcagcagacgggtgtgctgggtgcctttgagagccgcttctggcacatgcaggagaag
ctggggactgtgcaggggattgtgggtacccgcaacacctcagctgcctccactgcgcaa
cttgtggaggccacagaggagctacggcgtgaaattggggaggccactgagcacctgacc
cagctggaggcagaactgactgatgtgcaggatgagaacttcaatgccaaccatgcactg
agcagtctggagcgagatgggcttgcacttaatctcacactgcggcagctggaccagcat
ttggacctgctcaagcattcaaacttcctgggtgcctatgacagcatccgccatgcccac
agtctgtctgcagaggcggaacgtcgtgccaacacatcagccctgacagtgcccagtcct
gtgagcaactcagcagatacccggcacaggacagaggtgctaataggtgccaagaaggag
gacttcaaccgcaagcacatggccaaccagcaggcactaggcgagctctcagcccgtacc
cagtccctgagcctgacaggcatcaatgaactggtgtgtgggcccccaggggatgcaccc
tgtgcaacaagcccttgcgggggtgctggctgcctggacgaggatgggcaaccccgctgt
gggggcctcagctgcaatggggcagtagccatggcggacctggcactgggtcgggcccgg
cacacgcaggcagagctgcagcgggcactggcagaaggtggcggcatcctcagccaggtg
gctgagacccgtcggcaggcaggagaggcacagcagcgggcccaggcagccctggacaag
gctaatgcttccaggggacaggtggagaaggccaaccaagaacttcgggaacttatccag
agtgtgaaggacttcctcagccaggagggggctgatcctgatagcattgagatggtggcc
acacgagtgctagagctctccatcccagcatcacctgagcaaatccagcacctggcaggc
gcaattgcagagagggtccagagcctggcggatgtggacacaatcctggcacgcaccgtg
ggagatgtacgtcgggcagaacagctattgcaagatgcacggcgggcaaggagccgggct
gagggtgagaaacagaaggcagaaacagtacaagcagcactggaggaagcccagagggca
cagggagctgctcagggtgccatccaaggggcggtagttgacacacaggacactgagcgg
acactgcatcaggttcaggagaagatggcaggtgcagagcaggcactgagctctgcaggc
gagcgggctcagcaattggatggtcttctggaggctctgaaattgaaacgagcagggaat
agcctggcagcctctagtgcggaagaaacagcgggcagtgcccagggtcgtgcccgagag
gctgagcagctgctgcagggcccactaggcgaccagtaccaaacagtgaaggccttggct
gagcgcaaggcccagggtgtgttggctgcacaggcacgggcagagcaacttcgggatgaa
gctcgaggcttgttgcaggctgctcaggacaagctgcaacggctacaagagctggagggc
acctatgaagagaacgagcgggcactggaaggcaaagcagcccagctggatgggctggag
gccaggatgcgtagcgtgcttcaagccatcaacttgcaggttcagatctacaacacctgc
cagtga

DBGET integrated database retrieval system