KEGG   Felis catus (domestic cat): 101082217Help
Entry
101082217         CDS       T02385                                 

Definition
uncharacterized LOC101082217
Orthology
K11252  
histone H2B
Organism
fca  Felis catus (domestic cat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101082217
  Immune diseases
   05322 Systemic lupus erythematosus
    101082217
  Substance dependence
   05034 Alcoholism
    101082217
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 234 aa AA seqDB search
MLKGLKERMNVDRHHKKFKLPDSHYDWLIRSQAPGCANTCDTAWHSDHLRQPVPTLPAEL
SGSFATFFPRVLKQVHEGLSLSQEVVGIMDLFDKDIFECIAQEAAPLALYTVTSREIQTA
MRLLQPQEIGKHAVSEATKAFIRMRRQKEKETSQLAERAGADSPAKQLGGWGTRATNCLS
LPGSSREEWFLCTSDGLKHSKAFYTSDGPDTRVRFKRSTRVLVSHIAQLLCDLG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagggcctaaaagaaagaatgaatgttgacagacaccacaagaagtttaagtta
cctgattcccactatgattggttgatacgaagtcaagctccagggtgtgcaaacacatgt
gacacagcctggcatagtgaccatcttcgccagccagtgcctacccttcctgctgagctg
tcaggaagttttgccaccttcttccccagagttctgaagcaggttcatgagggcctgagc
ctctcacaggaggtcgtgggcatcatggatttgttcgataaggacatctttgagtgcatt
gctcaagaggctgctcctctggccctatacactgtcacctccagggagatccaaacagcc
atgcgcctgctccagccccaggagattggcaagcacgcggtgtctgaggccaccaaggcc
ttcatcagaatgaggaggcaaaaggaaaaggagacatctcaactggcagaaagagcagga
gctgattcccctgcgaagcagcttggaggctggggaactagggcgaccaactgtctcagc
ctgccaggttcatccagagaagaatggttcctgtgcacctctgatgggctcaaacattca
aaggccttttacacatctgatggaccagacacgagagtgagattcaagagatcaaccagg
gtcctggtgtcacatatagcccagttgctatgtgatcttgggtaa

DBGET integrated database retrieval system