KEGG   Felis catus (domestic cat): 101082485Help
Entry
101082485         CDS       T02385                                 

Gene name
STAMBP
Definition
STAM binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101082485 (STAMBP)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101082485 (STAMBP)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M67
   101082485 (STAMBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A3
AA seq 424 aa AA seqDB search
MSDHGDVSLPPEDRVRALSQMGSAVEINEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKLAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTE
YNEEKKREAEELARNVAIQQELEKERQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLK
IVQEFGKVDPGLGGPLVPDLEKPSPDAFPAVPATSTQPADCNTAGRPAKPPVVDRSLKPG
ALSNSESTPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL
IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggagacgtgagccttccgcccgaagaccgggtgagggctctctcccag
atgggtagtgcagtggagataaatgaagacattccaccccgacggtacttccgctctgga
gtcgagattatccgaatggcatccatttactctgaggaaggcaacattgaacatgccttc
atcctctataacaagtatatcacgctctttattgagaaactaccaaagcatcgggattac
aaattggctgtcattcctgaaaagaaagacacagtaaagaagttaaaggagattgcattt
cccaaagcagaagagctgaaggcagagctactgaaacgatataccaaagaatatacagaa
tataatgaagaaaagaagagggaagcggaagagcttgcccggaatgtggccatccagcag
gagctggagaaggagaggcagagggtggcacagcagaaacagcagcagttggagcaggag
cagttccatgcctttgaggagatgatccggaaccaggagctggaaaaggagcgactgaaa
atcgtgcaggaatttgggaaggtggaccctggcctagggggcccactggtgcctgacttg
gagaagccttccccagatgcgttccccgctgtacctgccacgtccacacagcctgcggac
tgtaatacggcgggaaggcctgccaagccacccgtggtggacaggtccttgaaacctgga
gcgttgagcaactcagaaagtactcctacaatcgacggactgcgccatgtggtggtgcct
gggaggctctgcccgcagttcctccagttagccagtgccaacactgcccggggagtagag
acatgtggaattctctgtggaaaactgatgaggaatgaattcaccattacccatgttctc
atccccaagcaaagtgccgggtctgattattgcaacaccgagaacgaagaagaacttttc
ctcatacaggatcagcagggtctcatcacactgggctggattcatactcatcccacgcag
accgccttcctctccagtgttgacctacacactcattgttcctaccagatgatgttgcca
gagtcaatagccattgtttgctcccccaagttccaggaaactggattctttaaactaact
gaccatggactagaggagatttcctcctgtcgccagaaaggatttcatccacacagcaaa
gatccacctctcttctgcagctgcagccacgtgaccgttgtggacagagcagtgaccatc
acagaccttcgatga

DBGET integrated database retrieval system