KEGG   Felis catus (domestic cat): 101082637Help
Entry
101082637         CDS       T02385                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101082637 (FLNA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101082637 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101082637 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    101082637 (FLNA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082637 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 2647 aa AA seqDB search
MSSSHSRAGQSAAGAAPGGGTDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVDVVI
QDPTGQKGAVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
GACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRIQVQDNEGCPVE
ASVKDNGNGTYSCSYVPRKPVKHTAVVSWGGVNVPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGIELGKPTHFTVNAK
AAGKGKLDVQFTGLAKGDVARDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKITGPSGTVVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEALPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGMGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVMYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNQDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPTAQPPLRPQQLAPPYTYPQGGQQTWAPERPLMGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLSHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKTASAPQHGAPGAGSTDASKVLAKGLGLSKAYAGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVLVP
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactcccgggcgggccagagcgcggcaggcgcggctccgggcggcggt
accgacacgcgggacgccgagatgccagccaccgagaaggacctggcggaggacgcgccg
tggaagaagatccagcagaacacgttcacgcgctggtgcaacgagcacctcaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgatgggctgcggctcatcgcactg
ctggaggtgctcagccagaagaagatgcaccgcaagcacaaccagaggcccaccttccgc
cagatgcagctggagaacgtgtcggtggcgctcgagttcctggaccgcgagagcatcaag
ctcgtgtccatcgacagcaaggccatcgtggatgggaacctgaagctgatcttaggcctc
atctggaccctgatcctgcactactccatctctatgcccatgtgggatgaggaggaggac
gaggaagccaagaagcagacccccaagcagcggctcctgggctggattcagaacaagctg
ccacagctgcccatcaccaactttagccgggactggcagagcggcagggccctgggcgcc
ctcgtcgacagctgtgccccaggcctgtgtcctgactgggactcctgggacgccagcaag
cccgtgaacaacgcgagggaggccatgcagcaggccgatgactggctgggcattcctcag
gtgatcacgcccgaggagatcgtggatcccaacgtagacgagcactccgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggctccgctgcggcccaaactaaac
ccaaagaaagcccgcgcctacgggccaggcatcgagcccacgggcaacatggtgaagaag
cgggcagaattcacggtggagaccagaagcgccggccagggagaggtgctggtgtatgtg
gaggacccggccggccaccaggaggaggcaaaggtgacagccaataatgacaagaaccgt
accttctctgtctggtacgtccccgaggtgaccgggactcacaaggtcaccgtgctcttt
gccggccagcatatcgccaagagtcccttcgaggtgtatgtggacaagtcccagggtgat
gccagcaaagtgactgcccagggccccggcctggagcccagtggcaacattgccaacaag
accacctactttgagatcttcacggcaggagctggcacgggtgaggtggacgttgtgatc
caggaccccacgggacagaagggcgccgtggagccccagctggaggcccggggcgacagc
acataccgctgcagctaccagcccaccatggagggcgtccacacggtgcacgtcactttt
gccggcgtgccgatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
ggtgcctgccgcgccgtcggccggggcctgcagcccaagggtgtgcgggtgaaagagact
gcggacttcaaggtgtacacgaagggcgcgggcagcggggagctgaaggtcaccgtgaag
ggtcccaagggtgaggagcgtgtgaagcagaaggacctgggggacggcgtttatggcttc
gagtattaccccatggtccccggcacctacactgtcaccatcacgtggggcggccagaac
attgggcgcagtcccttcgaggtgaaggtgggcacggagtgtggcaatcagaaggtgcgg
gcctggggccctgggctggaagggggtgtcgtcggcaagtcagcagactttgtggtggag
gccatcggggacgatgtcggcaccttgggcttctcggtggagggcccatcgcaggccaag
attgaatgcgacgacaagggcgacggctcctgtgatgtgcgctactggccccaggaggct
ggcgagtatgcagtgcatgtgctgtgcaacagtgaggacatccgcctcagccccttcatg
gccgacatccgtgaggcgccccaggacttccacccagatagggtgaaggcgcgcgggcct
gggttggagaagacgggtgtggccgtcaataagccagccgagttcacggtggatgccaag
catggcgggaaggcccctctccggatccaagtccaggacaacgagggatgccccgtggag
gcgtcggtcaaggacaacggcaacggcacttacagctgctcctacgtgcccaggaagcct
gtgaagcacacggccgtggtgtcctggggaggcgtgaacgtccccaacagccccttccgg
gtgaacgtgggagccggtagccacccaaacaaggtcaaggtgtatggccccggagtagcc
aagaccgggctcaaggctcatgaaccaacgtacttcactgtggattgcacagaggccggc
cagggtgatgtcagcatcggcatcaagtgtgctcctggcgtggtgggccccactgaggcc
gacattgacttcgacatcatccgtaatgacaatgacaccttcacggtgaagtatacaccc
cgcggggccggtagctataccatcatggtcctctttgccgaccaggccacacccaccagc
cccatccgggtcaaggtggagccctcccacgatgccagcaaggtgaaggctgagggccct
ggcctcagtcgcactggtattgagcttggcaaacccacccacttcacggtcaatgccaaa
gctgctggcaaaggcaagctggacgtccagttcacaggactggccaagggggatgtggcg
cgtgatgtggacatcatcgaccaccatgacaacacctacacggtcaagtacactcccgtg
cagcagggtccagtcggcatcaatgtcacttacggaggggatcccatccccaagagcccc
ttctcggtgggagtgtctccaagcctagacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagatcaggaattcacagtcaaatcgaagggcgctggtggc
caaggcaaagtggcatccaagatcacaggcccctcgggcactgtagtgccctgcaaggtg
gagccaggcctaggggctgacaacagtgtggtgcgctttgtgccccgagaggaggggccc
tatgaggtcgaggtgacttatgatggtgtgcctgtgcccggcagcccctttcctctggaa
gccctgccccccaccaagcctagcaaggtgaaggcgtttgggccgggcctgcaggggggc
agcgcaggctcccccgcccgcttcactatcgacaccaagggtgctggcatgggtggcctg
ggcctgacggtggaaggcccctgcgaggcccagctcgagtgcctggacaacggagacggc
acgtgctccgtgtcctatgtgcccaccgaacccggggactacaacatcaacatccttttt
gccgacacccacatccctggctcccccttcaaggctcacgtggtcccctgcttcgacgcg
tccaaagtcaaatgctcaggccccgggttggagcgggccactgctggtgaggcgggccag
ttccacgtggactgctcgagtgcgggcagcgcagagctgaccatcgaaatccgctctgag
gcagggctgcccgctgaggtgcacatccaggaccacggcgacggtacccacaccatcacc
tacatcccgctttgccccggggcctacaccgtcactatcaagtatggtggccagcccgtg
cccaacttccccagcaagctacaggtagagcccgcggtggacacttcaggcgtccagtgc
tatgggcctgggatcgagggccaaggtgtcttccgagaggctaccaccgagttcagcgtg
gatgcccgcgctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgaccgagacgtacgtgcaggactgtggtgacggcacgtacaaagtggag
tacacaccttacgaggagggactccattctgtggacgtgacctatgacggcagccccgtg
ccaagcagccccttccaggtgcctgtgaccgagggctgtgacccttcccgggtgcgtgtc
catgggccaggtatccaaagcggcacaaccaacaaacccaacaagttcaccgtggagact
aggggagccggcactggtggcctgggcctggccgtagagggcccctccgaggccaagatg
tcctgcatggacaacaaggatggcagctgttcagtcgaatacatcccctatgaggctggc
acctacagccttaacgtcacctatggtggccaccaagtaccaggcagtcccttcaaggtc
cctgtgcatgacgtgacggacgcatccaaggtcaagtgctccgggcctggcctgagccct
ggcatggtccgcgccaacctccctcagtccttccaggtagacacgagcaaggccggcgtg
gccccactgcaggtcaaagtgcaggggcccaaaggcctggtggagcctgtggacgtcgtg
gacaatgcggatggcacccagactgtaaactacgtgcccagccgggaggggccctacagc
atctccgtgatgtacggggaggaggaggtaccccgcagccccttcaaggtcaaggtgctg
cctacacacgatgccagcaaggtgaaggccagcggccccgggctcaatacgactggcgtg
cccgccagcctccctgtggagttcaccatcgatgcaaaggatgcaggagagggcctgctg
gctgtccagatcacggaccccgagggcaagcccaagaagacgcacatccaagacaaccag
gacggcacgtacaccgtggcctatgtgccggatgtgaccggccgctacaccatcctcatc
aagtacggtggtgacgagatccccttctccccgtatcgcgtccgggccgtgcccaccgga
gatgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggcatt
ggccccaccatccagattggggaggagacggtgatcaccgtcgacaccaaggcagcaggc
aaaggcaaggtgacctgtactgtgtgcacacccgacggctcggaggtagatgtggacgtg
gtagagaacgaggacggcacctttgacatcttctacacggccccccagccgggcaaatat
gtcatctgcgtgcgctttggtggcgagcacgtgcccaacagccctttccaagtgacggct
ctagctggggaccagcccacagcacagcccccacttcggcctcagcagctggccccaccg
tacacctatccccagggtggccagcagacctgggccccagagagacccttaatgggtgtc
aatgggctggatgtgaccagcctgaggcccttcgacctcgtcatccccttcaccatcaag
aaaggcgagatcactggggaggtgcggatgccttcgggcaaggtggcgcagccagccatc
actgacaacaaggacggcactgtgaccgtgcgctatgcacccagcgaagcaggcctgcac
gagatggacatccgctacgataacatgcacatcccaggaagccccctgcagttctacgtg
gactatgtcaactgcggccacgtcaccgcctatgggcctggcctcagccacggagtggtg
aacaagcccgcggtcttcaccgttaacaccaaggatgcgggagaggggggcctgtccctg
gccattgagggcccatccaaagcagagatcagctgcaccgacaaccaggatggcacgtgc
agcgtctcctaccttcccgtgctgcccggggactatagcatcctggtcaagtacaacgag
cagcacatcccgggcagccccttcaccgccagggtcacgggcgacgactcgatgcgcatg
tcccacctgaaggtgggctccgccgccgacatccccatcaatatctccgagacggacctc
agcctgctgacagccacggtagtgccaccctcgggccgggaggagccctgtctcctgaag
cgactgcgcaatggccacgtggggatctcattcgtgcccaaggagacgggggagcacctg
gtgcacgtgaagaagaatggccagcacgtggcaagcagccccatcccagtggtgatcagc
cagtcggagatcggggatgccagccgtgtgcgggtctcaggccagggcctccacgagggc
cacacctttgagcctgcagagtttatcatcgacacccgtgatgcaggctacggcggactt
agcctgtccatcgagggccccagcaaggtggacatcaacacagaggacctggaggatggc
acgtgcagggtcacctactgccccacagagcccggaaactacatcatcaacatcaagttc
gctgaccagcacgtgcctggcagccccttctctgtgaaggtaacaggagagggccgggtg
aaagagagcatcacacgccggcgacgggccccctcagtggccaatgtcggcagtcactgc
gacctcagcctgaagatccctgaaattagcatccaggacatgacagcccaggtgaccagc
ccatcaggcaagagccatgaggccgagatcgtggaaggggagaaccacacctattgcatc
cgctttgtgcctgccgagatgggcatgcacacagttagcgtcaagtacaagggccagcac
gtgcccgggagccccttccagttcaccgtggggcccctgggggaagggggagcacacaag
gtccgcgctggaggccctggcctggagagggctgaagccggagtgccagccgaatttagc
atctggaccagggaagctggcgccgggggcctggccattgctgtcgagggccccagcaag
gccgagatctccttcgaggaccgcaaggacggctcctgtggcgtggcctacgtggtccag
gagccaggtgactacgaggtctcagtcaagttcaacgaggagcacatccctgacagcccc
ttcgtagtacctgtggcttctccgtctggcgatgcccgccgccttactgtttctagtctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaacggggcc
aagggggcgatcgatgctaaggtgcacagcccctcgggagccctggaggagtgctatgtc
acagagatcgaccaagataagtatgccgtgcgctttatcccacgggagaacggtgtctac
ctgattgacgtcaagttcaacggcacccacattcctggaagccccttcaagatccgagtt
ggggagcctgggcacggaggggacccgggcctggtgtccgcctacggagccggcctggaa
ggtggtgtcacagggagcccagcagagttcatcgtgaacacgagcaacgcgggagccggc
gccctgtccgtaaccatcgatgggccctccaaggtgaagatggactgccaagagtgccct
gagggctaccgggtcacctacacccccatggcacctggcagctacctcatctccatcaag
tacggtggcccctaccacatcgggggcagccccttcaaggccaaagtcacaggtccccgt
cttgtcagcaaccacagcctccatgagacatcgtcagtgttcgtggactccctgacgaag
actgccagtgccccccagcacggggccccaggcgcaggttccactgacgccagcaaggtg
ctggccaagggcctggggctgagcaaggcgtacgccggccaaaagagcagcttcacggtg
gactgtagcaaagcaggcaacaacatgctgctggtaggggtgcatggcccccggacaccg
tgcgaggaaatcctggtgaagcatgtgggcagccggctctacagcgtctcttacctgctc
aaggacaagggagagtacacgctggtggtcaagtggggtgacgagcacatcccaggcagc
ccctaccgtgtcctggtaccctga

DBGET integrated database retrieval system