KEGG   Felis catus (domestic cat): 101082651Help
Entry
101082651         CDS       T02385                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101082651 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B1
AA seq 811 aa AA seqDB search
MSLQICNDENVTGDKSAENCEFLFSPPEPTGRLSVLRLSQKENVPPKSVVKATKVTFQTP
LRDPQTHRILSPGMSSKPEAPFALEDTVGLENSHQNWAQKQNQQFTKEVDTKMTNGIVQK
PLMGNASLPPGDVRPASEDRPYSSGPTSAPLASLGPSSSPQMPESLENQVASLGQTSGSP
EQALEENACSCFFEESIISTSEILEDPSQMALEDRTEGPRGAARESSSRVPASSAGATLP
PATLLKGAGGEGPLEDLPGEAPAGPEDTSGPGNTILDGPLNAGGATSPSPQKEEADGQQA
ASWRRGPTGLEFDLSANAVSRGKAGKGPGLKPPSRIPEPRQEKAPEEAGEGPVPLPRGSY
DLDWSKLDDPNFNPFESGGETLPPECPQSRPAATVTKQPQAGLEATGHCPLSQQVPSASA
DDIPVTQTAAGTPGAGGEDLRLPQGAPTEPSSFQEGAAGRASASAPPPPPHGPEPPSDLD
EEHFRDPAEVLGTGADVDYLEQFGSSSFKESALRKQSLYLKFDPLLKDSPQRPVPAAPDA
SRCDYLPLWGLSAQDVAAPSSGSLPEAKLLDLDFLGAPGAAVLDAPPCIFGPGGPLLPTG
PIVGSIVEVPQYSQKDMDAAVEAARQENVLLRSRCETLHAKNLEMGKIMDGFEGIVYQAM
EEAQKQKELAKAEIEKILKEKEQLTADLSSMEKSFSDLFKRFEKQKEVIEGYRTNEESLK
RCVEDYIARIEKEAQRYQALKAHAEEKLQRANEEIAQVRSKAQAEALAFQASLRKEQTRV
QSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatctgcaacgatgaaaacgtcactggtgacaaaagtgcagaaaactgt
gagttcctgttttcgccaccagaacctaccggaagattatctgtgcttcgtctgtcccag
aaagaaaatgtgccacccaagagcgtagtcaaagctacgaaagtgacttttcagactcct
ctgcgagacccacagacgcaccgcatcttgagtcctggcatgagcagcaagcccgaggct
ccttttgctctggaggacactgttgggctggaaaattctcaccaaaactgggcccagaaa
cagaaccaacagttcaccaaggaagttgacaccaaaatgaccaatggaattgtccagaaa
ccattgatgggcaatgccagcctgcctccaggggatgtgagaccagcctctgaagatagg
ccgtattccagtggacccacctctgctcccctggccagcctgggtccctcaagctctccc
cagatgccagaaagtcttgaaaatcaagtggcatctctaggacaaacgtctgggagccct
gagcaagccttggaggaaaatgcgtgttcttgtttcttcgaggaaagtattatatccacc
tcagaaatcctagaagacccttcccagatggctctcgaggacagaacggaaggtcctcgt
ggggctgccagagaaagctccagccgggtccctgcttcctcagccggggctactttgccc
cctgctactctcctcaaaggagcaggtggagaagggcccctcgaagacctgcctggcgag
gcccccgctggccctgaagacacttctggtcctgggaacaccatcctggacggccccctg
aacgctggaggggccacatccccaagtcctcagaaggaagaagccgacggccagcaggct
gcctcttggaggcgcgggcccacagggctagaatttgatttgtctgccaatgccgtcagc
agagggaaagcggggaagggacccggcctgaaacctccctctaggataccagagccgagg
caggaaaaggcacccgaggaggcaggtgaggggcccgttcccctcccccgggggtcttac
gacctggattggagcaagctggatgacccgaactttaacccatttgaaagtggaggagag
accctacccccagagtgcccccagagcaggcccgcagcgactgtgaccaagcagccgcag
gccggcctggaggccacagggcactgccccctgagccagcaggtgccttcggcctcagca
gatgacatacccgtgacgcagaccgcggcagggaccccgggcgcagggggcgaggacctt
cggctgccccagggtgcccccacggagccatcctccttccaggagggagccgcgggccgt
gccagtgcgtcagcaccgccccctcctccgcacgggccggagcccccctcggacctggat
gaggagcacttccgagaccccgctgaggttctaggcacgggggccgacgtggactatctg
gagcagttcgggagttcctcgtttaaggagtcagccctgaggaaacagtccctgtacctc
aagtttgacccgctcctgaaggacagccctcagagaccggtgcccgcggccccggacgcc
agcaggtgcgattaccttcccttgtggggtctcagcgcacaggacgtggctgcgccgtcc
tcgggaagcctgcccgaggcgaagctgctggacctggacttcctaggagccccgggcgcc
gccgtgctggacgcccctccgtgcatcttcgggcctgggggtcccctgctgcccacgggc
cccatcgtgggctccatcgtggaggtgccacagtatagccagaaggacatggacgcggcg
gtggaagccgcacgacaggagaacgtgctgctcaggagcaggtgtgagacgctccacgcg
aaaaacctggaaatggggaagataatggacgggttcgaggggatcgtgtaccaggcgatg
gaggaggctcagaaacagaaggaactcgcaaaagctgagatcgagaagattctgaaggag
aaggagcagctgactgcagacctgagctccatggaaaagtctttctctgacctgttcaag
cggttcgagaaacagaaggaggtgatcgaggggtaccgcacgaacgaagagtcgctgaag
agatgtgtggaggattacatagcgaggattgaaaaggaggcccagcggtaccaggccctg
aaggcccacgcggaggagaaactccagcgcgccaacgaggagatcgcccaggtgcgcagc
aaggcccaggcggaggccttggccttccaggccagcctgaggaaggagcagacgcgcgtc
cagtcactggagaagacggttgagcagaagactaaggaaaacgaggaactgacccgaatc
tgtgatgacctcatttccaagatggagaagatctga

DBGET integrated database retrieval system