KEGG   Felis catus (domestic cat): 101082684Help
Entry
101082684         CDS       T02385                                 

Gene name
CPB1
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
fca  Felis catus (domestic cat)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    101082684 (CPB1)
   04974 Protein digestion and absorption
    101082684 (CPB1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     101082684 (CPB1)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   101082684 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C2
AA seq 430 aa AA seqDB search
MQVKHTQRTKSVTMLVLLLLVTVALASAHHSGEHFEGEKVFRVNVEDENHISLLHELAST
TQIDFWKPDSVTQIKPHSTVDFRVKAEDIFTVEDFLKQHELQYEVLISNLRSVLEGQFDS
QVRATGHSYEKYNKWETIEAWTQQVATENPGLISRRAIGTTFEGRTMYLLKVGKARPHKP
AIFMDCGFHAREWISPAFCQWFVREAIRTYGHETHMTELLNMLDFYVLPVVNIDGYIYTW
TKNRMWRKTRSTQIGTTCIGTDPNRNFDAGWCKVGASRKPCDDTYCGPAAESERETKALA
NFIRSNLSSIKAYVTIHSYSQMMLYPYSYDYKLTENNAELNALAKATVRELATLYGTKYT
YGPGATTIYPAAGGSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIRPTCEETMLAIKH
LARYVMEHPY
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaaacacacccaaaggaccaagtcagtcacaatgttggtgctcttacttctt
gtgaccgtggccctagcatctgctcaccattctggtgagcactttgaaggtgagaaggtg
ttccgtgtcaatgttgaagatgaaaatcacatcagcttactccatgagttggccagcacc
acccagattgacttctggaaaccagattctgtcacacagattaaacctcacagtacagtt
gacttccgtgttaaagcagaagatattttcactgtggaagattttctgaagcaacatgaa
ctacaatatgaggtattgataagcaacctgagatctgtgttagaaggccagtttgacagc
caggtccgtgccactggacacagttatgagaagtacaacaaatgggaaacgatagaggct
tggactcaacaagtcgccactgagaatccaggcctcatctctcgcagagccatcggaacc
acatttgaaggacgcactatgtatctcctcaaggttggcaaagctagaccacataagcct
gccattttcatggactgtggtttccatgccagagagtggatttcccctgcattttgccaa
tggtttgtgagagaggctattcgcacctatggacatgagacccacatgacagaacttctc
aacatgttagacttttatgtcttgcctgtggtcaatattgacggctatatctacacctgg
accaagaaccgaatgtggagaaagactcgctccacccagattggaaccacctgcattggc
acagaccccaacagaaattttgatgctggttggtgcaaagtcggagcctctcgaaagccc
tgtgatgacacttactgtggacctgctgcagagtccgaaagagagaccaaggccctggct
aatttcatccgcagcaacctctcttccatcaaagcatatgtgacaatccactcatactcc
caaatgatgctctatccttactcctatgattataaactcacagagaacaatgctgagttg
aatgccctggctaaagctaccgtaagagaacttgccacactgtatggcaccaagtacaca
tatggcccaggagctacaacaatctatcctgctgctgggggctctgatgactgggcttat
gaccaaggaatcaaatattcttttaccttcgaactccgggataaaggcagatatggcttt
gtcctccctgaatcccagattcggccaacctgtgaagaaacgatgctagccatcaagcat
cttgccagatacgtcatggaacatccatactag

DBGET integrated database retrieval system