KEGG   Felis catus (domestic cat): 101082793Help
Entry
101082793         CDS       T02385                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
fca  Felis catus (domestic cat)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fca00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E1
AA seq 515 aa AA seqDB search
MSGSSPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLLEYEDMFPYEGHLRLLRA
KHAYSPPEIKEILHLAALNELEVIPLVQTFGHMEFVLKHEALAHLREVALFPNTLNPHEA
ESLALVGAMISQVMELHPGARWLHVGCDEVYYLGEGEASRRWLRQEHNTKARLCLSHMKA
VACHVLARHPATTPLVWDDMLRAIPEDQLSASGVPQLVEPVLWDYGADLDIHGKALLMEK
YRRCGFLRLWAASAFKGATGASQALTPIEHHLRNNVQWLQVAASGPADMLQGIVLTGWQR
YDHFSVLCELLPVGIPSLAVCLQSLLHGGFTEDVKARVENFLGISSLEITDLMRXPAHPQ
PCLCPRTLWTRLSTVALRAARGPAPSLAATSWPSSRTSASTCAALWTRSWRGTGTXPAGS
APITAGGSSSTRSWSSTSSPRRSASWPGGAPWCRSWRPPCIVSSTRTPWRSGWRRTRGPA
CSGCRLWCRTSGRRPAPAPAPAHTRVRTPEGRGRA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttcttcaccatttaagatgcgattagttcatctggaccttaaaggagctcca
ccaaaggtctcctacctctctgaggtctttcctctgttccatgccctgggcgccaatggg
ctgctcctcgagtatgaagacatgtttccctacgagggccacctgaggctgctgagggcc
aagcacgcgtacagcccccctgaaatcaaagagatcctgcatctggctgcactgaatgag
ctagaggtcattccattggtacagacatttggccacatggagtttgtgctgaagcacgag
gctctcgctcacctccgagaagtggcgctcttccctaacaccctgaacccccatgaggcg
gagtccctggctctggtgggagccatgatcagccaggtcatggagctgcacccgggcgcc
cggtggctccacgtcggctgcgacgaggtctattatcttggagagggtgaggcctcgaga
cggtggctgcgacaggagcataacaccaaagcaagactgtgtctgtcccacatgaaggcg
gtggcctgccacgtgctggcccggcaccccgccacgacgccactggtgtgggacgacatg
ctgcgggccatccccgaggaccagctctcagcatcaggggtgccacagctggtggagccc
gtgctctgggactacggggccgacctggacatccacggcaaagctctcctcatggaaaag
taccgcaggtgcggttttctccggctgtgggccgccagtgccttcaagggggccacaggg
gcgagccaggccctgacccctatcgagcaccacctcagaaacaatgtgcagtggctgcag
gtggcggccagcgggcccgcagacatgctgcagggcatcgtcctgaccggctggcagagg
tacgatcacttctccgtgctgtgcgagttgctgcccgtgggaatcccgtccctggccgtc
tgtctgcagtcgctcctacacggaggctttaccgaagacgttaaagcaagagtggagaac
tttcttgggatctcaagcctagaaataactgatcttatgaggtaacctgcccacccccag
ccctgcctctgccctcgcactctgtggacccgtctcagcacggtggctctccgtgcagcg
agggggccggctccttccctggcagcgacatcctggccctcgtcacgcacgtcggcctcc
acctgcgcagctctgtggacacgctcctggagagggacaggtacgtgaccggctggttca
gcccctatcaccgcgggcggaagctcatccacccggtcatggtccagcacatccagcccc
aggcgctcagcctcctggccaggtggagcaccttggtgcaggagctggaggccgccctgc
atcgtgtcttctacccggacgccgtggaggagtggctggaggagaacgcgcggcccagct
tgcagcggctgcaggctttggtgcaggacctcagggaggcggccggcgccggccccagcc
ccagcccacactcgggtcaggacccctgaggggaggggccgagcctga

DBGET integrated database retrieval system