KEGG   Felis catus (domestic cat): 101082793Help
Entry
101082793         CDS       T02385                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
fca  Felis catus (domestic cat)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101082793 (HEXDC)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     101082793 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 488 aa AA seqDB search
MTNSEMSGSSPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLLEYEDMFPYEGHL
RLLRAKHAYSPPEIKEILHLAALNELEVIPLVQTFGHMEFVLKHEALAHLREVALFPNTL
NPHEAESLALVGAMISQVMELHPGARWLHVGCDEVYYLGEGEASRRWLRQEHNTKARLCL
SHMKAVACHVLARHPATTPLVWDDMLRAIPEDQLSASGVPQLVEPVLWDYGADLDIHGKA
LLMEKYRRCGFLRLWAASAFKGATGASQALTPIEHHLRNNVQWLQVAASGPADMLQGIVL
TGWQRYDHFSVLCELLPVGIPSLAVCLQSLLHGGFTEDVKARVENFLGISSLEITDLMSE
GAGSFPGSDILALVTHVGLHLRSSVDTLLERDRYVTGWFSPYHRGRKLIHPVMVQHIQPQ
ALSLLARWSTLVQELEAALHRVFYPDAVEEWLEENARPSLQRLQALVQDLREAAGAGPSP
SPHSGQDP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagtgaaatgtcaggttcttcaccatttaagatgcgattagttcatctggac
cttaaaggagctccaccaaaggtctcctacctctctgaggtctttcctctgttccatgcc
ctgggcgccaatgggctgctcctcgagtatgaagacatgtttccctacgagggccacctg
aggctgctgagggccaagcacgcgtacagcccccctgaaatcaaagagatcctgcatctg
gctgcactgaatgagctagaggtcattccattggtacagacatttggccacatggagttt
gtgctgaagcacgaggctctcgctcacctccgagaagtggcgctcttccctaacaccctg
aacccccatgaggcggagtccctggctctggtgggagccatgatcagccaggtcatggag
ctgcacccgggcgcccggtggctccacgtcggctgcgacgaggtctattatcttggagag
ggtgaggcctcgagacggtggctgcgacaggagcataacaccaaagcaagactgtgtctg
tcccacatgaaggcggtggcctgccacgtgctggcccggcaccccgccacgacgccactg
gtgtgggacgacatgctgcgggccatccccgaggaccagctctcagcatcaggggtgcca
cagctggtggagcccgtgctctgggactacggggccgacctggacatccacggcaaagct
ctcctcatggaaaagtaccgcaggtgcggttttctccggctgtgggccgccagtgccttc
aagggggccacaggggcgagccaggccctgacccctatcgagcaccacctcagaaacaat
gtgcagtggctgcaggtggcggccagcgggcccgcagacatgctgcagggcatcgtcctg
accggctggcagaggtacgatcacttctccgtgctgtgcgagttgctgcccgtgggaatc
ccgtccctggccgtctgtctgcagtcgctcctacacggaggctttaccgaagacgttaaa
gcaagagtggagaactttcttgggatctcaagcctagaaataactgatcttatgagcgag
ggggccggctccttccctggcagcgacatcctggccctcgtcacgcacgtcggcctccac
ctgcgcagctctgtggacacgctcctggagagggacaggtacgtgaccggctggttcagc
ccctatcaccgcgggcggaagctcatccacccggtcatggtccagcacatccagccccag
gcgctcagcctcctggccaggtggagcaccttggtgcaggagctggaggccgccctgcat
cgtgtcttctacccggacgccgtggaggagtggctggaggagaacgcgcggcccagcttg
cagcggctgcaggctttggtgcaggacctcagggaggcggccggcgccggccccagcccc
agcccacactcgggtcaggacccctga

DBGET integrated database retrieval system