KEGG   Felis catus (domestic cat): 101082865Help
Entry
101082865         CDS       T02385                                 

Gene name
USP36
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 36 isoform X2
  KO
K11855  ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101082865 (USP36)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101082865 (USP36)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101082865 (USP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 101082865
NCBI-ProteinID: XP_019673899
UniProt: M3XAL3
Position
E1
AA seq 1102 aa AA seqDB search
MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLESLKSKY
VLLNPKTEGAGRHRSGDEPQARRQGSEHAYESCGDGVPAPQKVLFPTERLSLNWERVYRV
GAGLHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHARNCHQGSFCMLCVMQNHIVQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTL
VHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNLRPYMSQSSG
EPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSSVRSSNIKVVLNQQAYVLFY
MQIPGSKKSPDGSLPRTASSAPGWAGVVADRFRKNVGNGTLCSPLTGKRLDPATLKKLQA
TEELGVLVSRNGSVLGLKSQNGYVPPKPPLGSPSPRLSKTPPNTPTILDEPGKKVKKPTP
LHFVSPSRRASQGLHGTGTGSGGRGEGHRPGSWDGRAAAPSTSPRLPAGVTASGPAAGSE
RPEPDRRGSGGPSPEHSASSDPTKAPPTPESGAAPSGDSQGTNPRALPGGEDSKAAKPKP
PVLSTTATEPASIMSPPPAKKLALSAKKASTLRRAAGNDLRPPLSPLSDLTYPRKTTHPV
AASAWPVGAIRALSPAPRPSSRPKLPVGPCSSLSSSPQPLGTSDPQSCSSASAPLPQVNG
GFRAPPHQLPEASKPPRSLCKKRKRNRRGETQGRGSETCALAAAPPGKRRKKKGKRAEAV
DASPLQEGQVQRQHRGLERRKEGRAEVPVDRLEEEGGRQQENGQQAGCHVSGRKRRREGA
EGLGAEDGLPQDPPWHSCSLLDVTESEASAASPRKKKKKRRQQESRQEVQENELPEACRG
ETQRGPAVPGSQPSPAVNGRRPGDRAGQARAPRVSWVRDGEADVLQELLEYSSDKAYGRK
VLTWDGEVSAVSQDAIQDSRWARAATVIDDWDEEFDRGKEKKVKKFKKEKKRTFNAFQKL
QSRRNFWSVTHPAKATSLSYRR
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagtcgataagttgaaggaagccctgaaacccggccgcaaggactcggctgac
gatggagagctggggaagctcctggcctcctctgccaagaaagtccttctacagaagatt
gagttcgagccagccagcaagagtttctcttatcagctggagtccttaaagagcaaatat
gtcttgctgaaccctaaaacggagggagccggtcgccacaggagtggagatgagcctcag
gccaggagacagggcagcgagcacgcgtacgagagctgtggggacggcgtccccgcccca
cagaaagtgctcttccccaccgagcggctgtctctaaactgggagcgggtgtaccgcgtg
ggagcggggctccacaacctcggcaacacctgcttcttgaactcgaccgtacagtgcttg
acctacaccccacctctggccaactacctgctctccaaggagcatgctcgcaactgtcac
caaggcagcttctgcatgctgtgcgtcatgcagaaccacattgtgcaggccttcgccaac
agcggcaacgccatcaagcccgtctccttcatccgagacctgaaaaagattgcccggcat
ttccgctttgggaaccaggaggatgcacacgaatttctgcggtacaccatcgacgccatg
cagaaggcctgtttgaatggctgtgccaagttggatcgtcagacgcaggcaaccaccctg
gtccatcagatttttggaggctatctcagatcgcgtgtgaaatgctcggtgtgcaaaagc
gtctcagacacgtacgacccctacttggacgtagcgctggagatccggcaagccgctaat
attgtgcgcgctctggagctttttgtgaagccagatgtcctgagtggagagaacgcctat
atgtgtgcaaaatgcaagaagaaggttccggccagcaaacgcttcaccatccacagaacg
tccaacgtcttaaccctctccctcaaacgctttgccaacttcagtgggggaaagatcacg
aaggatgttggctacccggaattcctgaacctccgtccgtacatgtcccagagcagcggc
gagcccgtcatgtatgggctgtacgcggtcctcgtgcactctggctacagctgccacgcg
ggccactactactgctatgtgaaggcaagcaacggacagtggtaccagatgaacgattcc
tcggtccgttccagcaacatcaaggtggttctgaaccagcaggcctacgtgctcttctat
atgcaaatcccgggctctaagaagagtcctgacggctccctccccaggacggcgtcctcc
gctcccggctgggcaggtgtggtcgccgaccgcttcaggaagaatgttggcaacgggact
ctttgctccccgctgaccggaaagcgactggaccccgcgacgctgaagaagctacaggcc
actgaggagctcggcgtgcttgtttccagaaacggctccgtgttgggtctgaagtctcag
aatggatacgttcctccaaagccacccttggggtccccttccccccgactctccaaaaca
ccccccaacactccgaccattctggatgagcccggaaagaaagtcaagaagccgactccc
ctgcacttcgtgtccccgtcacgcagagcttctcaggggctccacggtaccggcaccggg
agcggcggcaggggcgagggccacaggcccggctcctgggacggcagggctgctgccccc
tctacctcacccaggctcccggccggagtgactgccagcgggcccgcggcgggcagcgag
cgtcccgagcccgacaggaggggttccggcggtcccagcccggagcactccgccagcagc
gaccccaccaaggcccccccaacgcccgagagcggagccgccccctcgggtgattctcag
ggaacaaaccccagagcgctgccgggcggagaggactccaaggcggcgaagcccaagccc
cccgtcctgagcaccaccgccactgagcccgcaagcatcatgtctcctccaccagccaaa
aaactggccctttctgccaagaaggccagcaccctgcggagggcagccggcaatgacctc
cgtccacccctctcaccattgtccgacctcacctaccccaggaaaaccactcacccggtc
gccgcctccgcctggcctgtcggtgccatcagggcgctctcacctgctcccagaccatcc
agccgtccgaagctccccgtcggcccctgctcgtcactgtccagtagcccccaacccctc
gggacgtcagacccacagagctgctcctccgcctctgctcccctgcctcaggtcaacggg
ggcttccgggcccctccacaccagctgccggaggccagcaagcccccccggagcctctgt
aagaagaggaagaggaaccggaggggagagacgcaggggcggggctcagagacgtgcgcc
ttggccgcagcccctcccgggaagaggagaaagaagaaggggaaacgcgcggaggccgtg
gacgcctcccccctgcaggaggggcaggtgcagaggcagcaccggggcctcgagcgcagg
aaggagggccgggcggaggtgcccgtggaccgcctggaggaggagggcggacggcagcaa
gagaacggccagcaagcggggtgccacgtgagcggcaggaagaggaggcgggagggagcc
gagggcctcggcgccgaagacggcctcccgcaggacccaccgtggcacagctgttctctc
ttggatgtcaccgagtcagaggccagtgcagcatctccaaggaaaaagaaaaagaaaaga
aggcagcaggagtcacggcaggaagtacaagagaacgagctccccgaagcctgcaggggc
gagacgcagaggggccctgccgtccctgggagccagccctcaccggccgtgaacggcagg
cggcccggggaccgagcagggcaggcacgggctcctcgcgtgtcctgggtccgagacggg
gaggccgacgtgctccaggagctgcttgagtattcctcagataaagcctacgggaggaaa
gtgttgacgtgggacggtgaggtgtcggccgtcagtcaggacgccattcaggacagcaga
tgggcccgcgcggccacggtgatcgacgactgggacgaagagttcgatcgagggaaggaa
aagaaagtgaaaaagttcaagaaagagaagaaaagaaccttcaacgccttccagaaactt
cagagtagacggaacttttggtctgtgactcacccagctaaggctaccagcctcagttac
cgccgctga

DBGET integrated database retrieval system