KEGG   Felis catus (domestic cat): 101082865Help
Entry
101082865         CDS       T02385                                 

Gene name
USP36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 872 aa AA seqDB search
QAANIVRALELFVKPDVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSG
GKITKDVGYPEFLNLRPYMSQSSGEPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQ
MNDSSVRSSNIKVVLNQQAYVLFYMQIPGSKKSPDGSLPRTASSAPGRAGVVADRFRKNV
GNGTLCSPLTGKRLDPATLKKLQATEELGVLVSRNGSVLGLKSQNGYVPPKPPLGSPSPR
LSKTPXNTPTILDEPGKKVKKPTPLXXXXXXXXXGTGSGGRGEGHSPGSWDGRAAAPSTS
PRLPAGVTASGPAAGSERPEPDRRGSGGPSPEHSASSDPTKAPPTPESGAAPSGDSQGTN
PRALPGGEDSKAAKPKPPVLSTTATEPASIMSPPPAKKLALSAKKASTLRRAAGNDLRPP
LSPLSDLTYPRKTTHPVAASAWPVGAIRALSPAPRPSSRPKLPVGPCSSLSSSPQPLGTS
DPQSCSSASAPLPQVNGGFRAPPHQLPEASKPPRSLCKKRKRNRRGETQGRGSETCALAA
APPGKRRKKKGKRAEAVDASPLQEGQVQRQHRGLERRKEGRAEVPVDRLEEEGGRQQENG
QQAGCHVSGRKRRREGAEGLGAEDGLPQDPPWHSCSLLDVTESEASAASPRKKKKKRRQQ
ESRQEVQENELPEACRGETQRGPAVPGSQPSPAVNGRRPGDRAANLGVDYRGKRYHEAVT
NKAASVSRKRPHGGGHGAAWPPSSDPGLLCQHVEHVETVLGPRGPPPGAGQARAPRVSWV
RDGEADVLQELLEYSSDKAYGRKVSLHEGLREWGRALFGNCDACGFLTQEKKVKKFKKEK
KRTFNAFQKLQSRRNFWSVTHPAKATSLSYRR
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
caagccgctaatattgtgcgcgctctggagctttttgtgaagccagatgtcctgagtgga
gagaacgcctatatgtgtgcaaaatgcaagaagaaggttccggccagcaaacgcttcacc
atccacagaacgtccaacgtcttaaccctctccctcaaacgctttgccaacttcagtggg
ggaaagatcacgaaggatgttggctacccggaattcctgaacctccgtccgtacatgtcc
cagagcagcggcgagcccgtcatgtatgggctgtacgcggtcctcgtgcactctggctac
agctgccacgcgggccactactactgctatgtgaaggcaagcaacggacagtggtaccag
atgaacgattcctcggtccgttccagcaacatcaaggtggttctgaaccagcaggcctac
gtgctcttctatatgcaaatcccgggctctaagaagagtcctgacggctccctccccagg
acggcgtcctccgctcccggccgggcaggtgtggtcgccgaccgcttcaggaagaatgtt
ggcaacgggactctttgctccccgctgaccggaaagcgactggaccccgcgacgctgaag
aagctacaggccactgaggagctcggcgtgcttgtttccagaaacggctccgtgttgggt
ctgaagtctcagaatggatacgttcctccaaagccacccttggggtccccttccccccga
ctctccaaaacacccnccaacactccgaccattctggatgagcccggaaagaaagtcaag
aagccgactcccctnnnnnnnnnnnnnnnnnnnnnnnnnnnnggcaccgggagcggcggc
aggggcgagggccacagtcccggctcctgggacggcagggctgctgccccctctacctca
cccaggctcccggccggagtgactgccagcgggcccgcggcgggcagcgagcgtcccgag
cccgacaggaggggttccggcggtcccagcccggagcactccgccagcagcgaccccacc
aaggcccccccaacgcccgagagcggagccgccccctcgggtgattctcagggaacaaac
cccagagcgctgccgggcggagaggactccaaggcggcgaagcccaagccccccgtcctg
agcaccaccgccactgagcccgcaagcatcatgtctcctccaccagccaaaaaactggcc
ctttctgccaagaaggccagcaccctgcggagggcagccggcaatgacctccgtccaccc
ctctcaccattgtccgacctcacctaccccaggaaaaccactcacccggtcgccgcctcc
gcctggcctgtcggtgccatcagggcgctctcacctgctcccagaccatccagccgtccg
aagctccccgtcggcccctgctcgtcactgtccagtagcccccaacccctcgggacgtca
gacccacagagctgctcctccgcctctgctcccctgcctcaggtcaacgggggcttccgg
gcccctccacaccagctgccggaggccagcaagcccccccggagcctctgtaagaagagg
aagaggaaccggaggggagagacgcaggggcggggctcagagacgtgcgccttggccgca
gcccctcccgggaagaggagaaagaagaaggggaaacgcgcggaggccgtggacgcctcc
cccctgcaggaggggcaggtgcagaggcagcaccggggcctcgagcgcaggaaggagggc
cgggcggaggtgcccgtggaccgcctggaggaggagggcggacggcagcaagagaacggc
cagcaagcggggtgccacgtgagcggcaggaagaggaggcgggagggagccgagggcctc
ggcgctgaagacggcctcccgcaggacccaccgtggcacagctgttctctcttggatgtc
accgagtcagaggccagtgcagcatctccaaggaaaaagaaaaagaaaagaaggcagcag
gagtcacggcaggaagtacaagagaacgagctccccgaagcctgcaggggcgagacgcag
aggggccctgccgtccctgggagccagccctcaccggccgtgaacggcaggcggcccggg
gaccgagcagcgaatctgggcgttgattaccgtgggaagcgctaccacgaggccgtgacg
aataaggcggccagcgtgtcgagaaaacgtccgcacggaggtggccacggagcagcctgg
ccgccgtcgtcagaccccggcttgctctgtcagcacgttgagcacgtggagacggtgctc
gggccacggggcccaccgcccggcgcagggcaggcacgggctcctcgcgtgtcctgggtc
cgagacggggaggccgacgtgctccaggagctgcttgagtattcctcagataaagcctac
gggaggaaagtaagccttcacgaggggctgcgggaatggggacgagccctttttgggaat
tgtgatgcctgcggtttcttgacgcaggaaaagaaagtgaaaaagttcaagaaagagaag
aaaagaaccttcaacgccttccagaaacttcagagtagacggaacttttggtctgtgact
cacccagctaaggctaccagcctcagttaccgccgctga

DBGET integrated database retrieval system