KEGG   Felis catus (domestic cat): 101082926Help
Entry
101082926         CDS       T02385                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101082926 (USP44)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101082926 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 711 aa AA seqDB search
MLTMDKCKHIGQLRLAQDHSILNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHAVRH
FQDSSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYQCTTRSGRVL
QSVGTSDDTYYLHDSTQSLLQNEDQMYTALWHRRRILMGKIFRTWFEQSPIGRKRQEEQF
QEKIAKREVKKRRQELEYQVKTELESIHPRKSLRLQGLAQSTTVEIVPVQVPLQTPASPA
KDKVVPTSEDVRLKKANDSSGKQRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCF
LKLDLNRWLAVTASDKTRSPYKHPPVTDTVYQMNECQEKDTGCVPSRHPSLSLGLSGGAS
KSRKMELIQPKEPSSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQ
QDAQEFLCELLDKIQHELETTGTRLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCVA
CDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCN
SKRRRFSSKSVVLTEARKQLMVCHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNME
PYCCRESLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCT
MDEVCKAQAYILFYTQRVTENGHSKLLPPELLSGSQHPNEEADTSSNEILS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaatggataagtgcaaacacattgggcagttgcggcttgctcaagaccattcc
atcctcaaccctcagaaatggcattgtgtggactgcaatacaactgagtcgatttgggct
tgccttagctgttctcatgttgcctgtggaagatatattgaagaacatgcagtcaggcac
tttcaagatagcagtcatcctgttgccttggaggtgaatgagatgtatgttttttgttac
ctttgtgatgattatgttcttaatgataatgctactggagacctgaagttactacgaagt
accttaagtgcaatcaaaagtcaaaattatcagtgcacaactcgtagtggaagggttttg
cagtctgtgggtacaagtgatgatacttattacttacacgatagcacccaatctctgctt
caaaatgaagatcaaatgtatactgctctttggcatagaagaagaatattaatgggtaaa
atctttcgaacttggtttgaacaatcacccattggaagaaaaagacaagaggaacaattt
caggaaaaaatagcaaaaagagaagtgaagaaaagacgacaagaattagagtatcaagtt
aaaacagaattggaaagtatacatccaagaaagagtttacgtttgcaaggtctagctcag
tctaccacagtagaaatagttcctgttcaagtaccactgcaaaccccagcatcaccagca
aaagataaagtagtacctacctcagaagatgtgagattaaaaaaagccaatgactcctca
ggtaaacaaaggccaatagtaactcctggtgtaactggattgagaaatttgggaaatact
tgctatatgaattctgttcttcaagtgttgagtcatttacttatttttcggcaatgtttt
ttaaaacttgatctgaaccgatggctggcagtgacagctagtgataagacaagatcacct
tataagcatccaccagtcacagatacagtatatcaaatgaatgaatgccaagaaaaagat
acaggctgtgttccctccagacatccaagtttatcattaggactaagtggtggagcatca
aagagtagaaagatggaacttattcagccaaaggaaccaagttcacaatacatttctctc
tgtcatgaattgcatactttgttccaagtcatgtggtctggaaagtgggccttagtctca
ccatttgctatgctacactccgtgtggagactaattccagcttttcgtggttatgcccaa
caggatgctcaggaatttctctgtgaacttttggataaaatacaacatgaactagagaca
actggtactaggttaccagctcttatccccacttctcaaaggaaacttatcaaacaggtt
ctgaatgttgtgaataatatttttcatggacaactacttagtcaggttacatgtgttgca
tgtgacaacaaatcaaataccatagaacctttctgggacttgtcattggaatttccagaa
agataccaatgcagtggaaaagatattgcttcccagccatgtctggttactgaaatgttg
gccaaattcacagaaactgaagctttagaaggaaaaatctacgtatgtgaccagtgtaac
tcaaaacgtagaaggttttcctcaaaatcagttgtactcacagaagcacgaaaacagctt
atggtttgtcacctacctcaggttctcagactacatctcaaacgattcaggtggtcagga
cgtaataaccgagagaaaattggtgttcatgttggctttgaagaaatcttaaacatggag
ccttattgctgcagggaatccctgaaatccctcagaccagaatgttttatctatgactta
tctgctgtagtaatgcaccatgggaaaggatttggctcaggacactacactgcctactgc
tataattctgaaggagggttctgggtacactgcaatgattccaagctaagcatgtgcact
atggatgaagtatgcaaggcccaagcttatatcttgttttatacccagcgagttactgag
aacggacattctaaactcttgcctccagaactcctgtctggtagccaacatcccaatgaa
gaagctgatacctcttctaatgaaatccttagctga

DBGET integrated database retrieval system