KEGG   Felis catus (domestic cat): 101082957Help
Entry
101082957         CDS       T02385                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101082957 (DBH)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101082957 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 610 aa AA seqDB search
MQVPSPSTREAASMYGTVVAIFLVILVATLQSSAPPENPFPYRVPLDPEGSLELSWNVSY
AQKTVHFQLLVQELKAGVLFGMSDRGELENADLVVLWTDGDSTYFGDAWSDQRGQIHLDS
RQDYQLLRARRTPEGLSLIFKRPFDTCDPKDYLIEDGTVHLVYGVLEEPFRTLEAINTSG
LQTGLQRVQLLKPSIPIPALPVDTHTMEIRTPDVLIPDQPTTYWCHITELPDGFSRHHIV
MYEPIVTKGNEALVHHMEVFQCAAQFETFPQFSGPCDSKMKPGRLNYCRHVLAAWALGAK
AFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLKIQGRRDSSGIRLHYTATLRRFDAGIMEL
GLVYSPVMAIPPRETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRD
GRETEIVNRDDHYSPHFQEIRMLKKTVSVRPGDVLVTSCTYNTEDRELATVGGFGILEEM
CVNYVHYYPQTQLEVCKSTVDPGFLREYFHLVNRFNGEEVCTCPQASVPEQFAAVPWNSF
NRDVLRALYGFAPISMHCNKSSAVRFQGEWNRQPLPEIISKLEEPTSHCPASQDQSPSSH
PVVNIGGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcacgagagaggcagcgtccatgtatggcacggtggtggcc
atcttcctggtcatcttggtggccacactgcagagctcggccccccccgagaaccccttc
ccctaccgagtgcccttggatcccgaggggtccctggagctttcctggaatgttagctac
gcgcagaagacggtccacttccaactcctggtgcaggagctcaaggccggggtcctgttt
gggatgtcggaccgcggcgagttggaaaatgctgacctggtggtgctctggaccgacgga
gacagcacctactttggggacgcctggagtgaccagaggggacagatccacctagattcc
cggcaggattaccagctgctgagggcgcggagaaccccggaaggcctgagcctgatcttc
aagaggccctttgacacctgtgaccccaaggattacctcattgaggatggcaccgtccac
ctggtatacggggtcctggaggagccgttccggacgctggaggccatcaacacctcgggg
ctgcagacggggctgcagagggtacagctgttaaagcccagtatccccatcccggccttg
cccgtggacacgcacaccatggagatccgcaccccggacgtcctgatccccgaccagccg
accacatactggtgccacatcactgagcttccagacggcttctcccggcaccacatcgtc
atgtacgagcccatcgtcaccaagggcaacgaggccctggtgcaccacatggaggtcttc
cagtgcgccgcccagtttgagaccttcccccagttcagcgggccctgcgattccaagatg
aagcccggacgcctcaattactgccgccacgtgctggccgcctgggccctgggtgccaag
gccttttactacccggaggaagcaggccttgcctttgggggcgccgggtcctccagattt
ctccgtctggaagttcactaccacaacccgctgaagatccaaggccgccgcgactcctcg
ggcatccgcctgcactacacggccacgctacgtcgcttcgacgcgggcatcatggagctg
gggcttgtgtactcgcccgtgatggccatccccccgcgggagacggccttcgtcctcacc
ggctactgcacggacaagtgcacccagctggccctgcctccctcagggatccacatcttc
gcctcccagctccacacacacctgacggggaggaaggtggtcactgtgctggtccgggac
ggccgagagacggagattgtgaacagggacgaccactacagccctcacttccaggagatc
cgcatgttgaagaagacggtgtccgtgcgcccgggggacgtgctcgtcacttcctgtacg
tacaacacagaagacagggagctggccaccgtggggggctttggtatcctggaggagatg
tgcgtcaactacgtccactactacccccagacgcagctggaggtctgcaaaagcaccgtg
gacccgggtttcctgcgggagtatttccacctggtgaacaggttcaatggtgaggaagtg
tgcacctgcccccaggcctctgtccctgagcagtttgccgcggttccctggaactccttc
aatcgagacgtgctcagggccctgtacggcttcgcccccatctccatgcactgcaacaag
tcctcggccgtccgcttccagggtgaatggaatcggcagcctctgcctgagatcatctcc
aagctagaagagcccacctctcactgcccagccagccaggatcagagcccctccagccac
cctgtggtcaacattggtgggggcaaaggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system