KEGG   Felis catus (domestic cat): 101082957Help
Entry
101082957         CDS       T02385                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fca00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 610 aa AA seqDB search
MQVPSPSTREAASMYGTVVAIFLVILVATLQSSAPPENPFPYRVPLDPEGSLELSWNVSY
AQKTVHFQLLVQELKAGVLFGMSDRGELENADLVVLWTDGDSTYFGDAWSDQRGQIHLDS
RQDYQLLRARRTPEGLSLIFKRPFDTCDPKDYLIEDGTVHLVYGVLEEPFRTLEAINTSG
LQTGLQRVQLLKPSIPIPALPVDTHTMEIRTPDVLIPDQPTTYWCHITELPDGFSRHHIV
MYEPIVTKGNEALVHHMEVFQCAAQFETFPQFSGPCDSKMKPGRLNYCRHVLAAWALGAK
AFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLKIQGRRDSSGIRLHYTATLRRFDAGIMEL
GLVYSPVMAIPPRETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRD
GRETEIVNRDDHYSPHFQEIRMLKKTVSVRPGDVLVTSCTYNTEDRELATVGGFGILEEM
CVNYVHYYPQTQLEVCKSTVDPGFLREYFHLVNRFNGEEVCTCPQASVPEQFAAVPWNSF
NRDVLRALYGFAPISMHCNKSSAVRFQGEWNRQPLPEIISKLEEPTSHCPASQDQSPSSH
PVVNIGGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcacgagagaggcagcgtccatgtatggcacggtggtggcc
atcttcctggtcatcttggtggccacactgcagagctcggccccccccgagaaccccttc
ccctaccgagtgcccttggatcccgaggggtccctggagctttcctggaatgttagctac
gcgcagaagacggtccacttccaactcctggtgcaggagctcaaggccggggtcctgttt
gggatgtcggaccgcggcgagttggaaaatgctgacctggtggtgctctggaccgacgga
gacagcacctactttggggacgcctggagtgaccagaggggacagatccacctagattcc
cggcaggattaccagctgctgagggcgcggagaaccccggaaggcctgagcctgatcttc
aagaggccctttgacacctgtgaccccaaggattacctcattgaggatggcaccgtccac
ctggtatacggggtcctggaggagccgttccggacgctggaggccatcaacacctcgggg
ctgcagacggggctgcagagggtacagctgttaaagcccagtatccccatcccggccttg
cccgtggacacgcacaccatggagatccgcaccccggacgtcctgatccccgaccagccg
accacatactggtgccacatcactgagcttccagacggcttctcccggcaccacatcgtc
atgtacgagcccatcgtcaccaagggcaacgaggccctggtgcaccacatggaggtcttc
cagtgcgccgcccagtttgagaccttcccccagttcagcgggccctgcgattccaagatg
aagcccggacgcctcaattactgccgccacgtgctggccgcctgggccctgggtgccaag
gccttttactacccggaggaagcaggccttgcctttgggggcgccgggtcctccagattt
ctccgtctggaagttcactaccacaacccgctgaagatccaaggccgccgcgactcctcg
ggcatccgcctgcactacacggccacgctacgtcgcttcgacgcgggcatcatggagctg
gggcttgtgtactcgcccgtgatggccatccccccgcgggagacggccttcgtcctcacc
ggctactgcacggacaagtgcacccagctggccctgcctccctcagggatccacatcttc
gcctcccagctccacacacacctgacggggaggaaggtggtcactgtgctggtccgggac
ggccgagagacggagattgtgaacagggacgaccactacagccctcacttccaggagatc
cgcatgttgaagaagacggtgtccgtgcgcccgggggacgtgctcgtcacttcctgtacg
tacaacacagaagacagggagctggccaccgtggggggctttggtatcctggaggagatg
tgcgtcaactacgtccactactacccccagacgcagctggaggtctgcaaaagcaccgtg
gacccgggtttcctgcgggagtatttccacctggtgaacaggttcaatggtgaggaagtg
tgcacctgcccccaggcctctgtccctgagcagtttgccgcggttccctggaactccttc
aatcgagacgtgctcagggccctgtacggcttcgcccccatctccatgcactgcaacaag
tcctcggccgtccgcttccagggtgaatggaatcggcagcctctgcctgagatcatctcc
aagctagaagagcccacctctcactgcccagccagccaggatcagagcccctccagccac
cctgtggtcaacattggtgggggcaaaggttga

DBGET integrated database retrieval system