KEGG   Felis catus (domestic cat): 101082957Help
Entry
101082957         CDS       T02385                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00350  Tyrosine metabolism
fca01100  Metabolic pathways
Module
fca_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101082957 (DBH)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101082957 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON
Motif
Other DBs
NCBI-GeneID: 101082957
NCBI-ProteinID: XP_003996085
Ensembl: ENSFCAG00000011138
UniProt: M3WEJ6
Position
D4
AA seq 610 aa AA seqDB search
MQVPSPSTREAASMYGTVVAIFLVILVATLQSSAPPENPFPYRVPLDPEGSLELSWNVSY
AQKTVHFQLLVQELKAGVLFGMSDRGELENADLVVLWTDGDSTYFGDAWSDQRGQIHLDS
RQDYQLLRARRTPEGLSLIFKRPFDTCDPKDYLIEDGTVHLVYGVLEEPFRTLEAINTSG
LQTGLQRVQLLKPSIPIPALPVDTHTMEIRTPDVLIPDQPTTYWCHITELPDGFSRHHIV
MYEPIVTKGNEALVHHMEVFQCAAQFETFPQFSGPCDSKMKPGRLNYCRHVLAAWALGAK
AFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLKIQGRRDSSGIRLHYTATLRRFDAGIMEL
GLVYSPVMAIPPRETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLVRD
GRETEIVNRDDHYSPHFQEIRMLKKTVSVRPGDVLVTSCTYNTEDRELATVGGFGILEEM
CVNYVHYYPQTQLEVCKSTVDPGFLREYFHLVNRFNGEEVCTCPQASVPEQFAAVPWNSF
NRDVLRALYGFAPISMHCNKSSAVRFQGEWNRQPLPEIISKLEEPTSHCAASQDQSPSSH
PVVNIGGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcacgagagaggcagcgtccatgtatggcacggtggtggcc
atcttcctggtcatcttggtggccacactgcagagctcggccccccccgagaaccccttc
ccctaccgagtgcccttggatcccgaggggtccctggagctttcctggaatgttagctac
gcgcagaagacggtccacttccaactcctggtgcaggagctcaaggccggggtcctgttt
gggatgtcggaccgcggcgagttggaaaatgctgacctggtggtgctctggaccgacgga
gacagcacctactttggggacgcctggagtgaccagaggggacagatccacctggattcc
cggcaggattaccagctgctgagggcgcggagaaccccggaaggcctgagcctgatcttc
aagaggccctttgacacctgtgaccccaaggattacctcattgaggatggcaccgtccac
ctggtatacggggtcctggaggagccgttccggacgctggaggccatcaacacctcgggg
ctgcagacggggctgcagagggtacagctgttaaagcccagtatccccatcccggccttg
cccgtggacacgcacaccatggagatccgcaccccggacgtcctgatccccgaccagccg
accacatactggtgccacatcactgagcttccagacggcttctcccggcaccacatcgtc
atgtacgagcccatcgtcaccaagggcaacgaggccctggtgcaccacatggaggtcttc
cagtgcgccgcccagtttgagaccttcccccagttcagcgggccctgcgattccaagatg
aagcccggacgcctcaattactgccgccacgtgctggccgcctgggccctgggtgccaag
gccttttactacccagaggaagcaggccttgcctttgggggcgccgggtcctccagattt
ctccgtctggaagttcactaccacaacccgctgaagatccaaggccgccgcgactcctcg
ggcatccgcctgcactacacggccacgctacgtcgcttcgacgcgggcatcatggagctg
gggcttgtgtactcgcccgtgatggccatccccccgcgggagacggccttcgtcctcacc
ggctactgcacggacaagtgcacccagctggccctgcctccctcagggatccacatcttc
gcctcccagctccacacacacctgacggggaggaaggtggtcactgtgctggtccgggac
ggccgagagacggagattgtgaacagggacgaccactacagccctcacttccaggagatc
cgcatgttgaagaagacggtgtccgtgcgcccgggggacgtgctcgtcacttcctgtacg
tacaacacagaagacagggagctggccaccgtggggggctttggtatcctggaggagatg
tgcgtcaactacgtccactactacccccagacgcagctggaggtctgcaaaagcaccgtg
gacccgggtttcctgcgggagtatttccacctggtgaacaggttcaatggtgaggaagtg
tgcacctgcccccaggcctctgtccctgagcagtttgccgcggttccctggaactccttc
aatcgagacgtgctcagggccctgtatggcttcgcccccatctccatgcactgcaacaag
tcctcggccgtccgcttccagggtgaatggaatcggcagcctctgcctgagatcatctcc
aagctagaagagcccacctctcactgcgcagccagccaggatcagagcccctccagccac
cctgtggtcaacattggtgggggcaaaggttga

DBGET integrated database retrieval system