KEGG   Felis catus (domestic cat): 101083046Help
Entry
101083046         CDS       T02385                                 

Gene name
ACACA
Definition
(RefSeq) acetyl-CoA carboxylase 1 isoform X6
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00061  Fatty acid biosynthesis
fca00620  Pyruvate metabolism
fca00640  Propanoate metabolism
fca01100  Metabolic pathways
fca01212  Fatty acid metabolism
fca04152  AMPK signaling pathway
fca04910  Insulin signaling pathway
fca04922  Glucagon signaling pathway
Module
fca_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    101083046 (ACACA)
   00640 Propanoate metabolism
    101083046 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    101083046 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    101083046 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101083046 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101083046 (ACACA)
   04922 Glucagon signaling pathway
    101083046 (ACACA)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     101083046 (ACACA)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     101083046 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     101083046 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp ATP-grasp_3 MetallophosN
Motif
Other DBs
NCBI-GeneID: 101083046
NCBI-ProteinID: XP_006940177
Ensembl: ENSFCAG00000010568
Position
E1
AA seq 2348 aa AA seqDB search
MDEPSPLAKPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLS
DLGISSLQDGLALHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYQKGYVKDVDDGLKA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQV
LPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFSGQCYA
EIEVMKMVMTLTAAESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSP
PQSPTFPEAGHTSLYDEDKFQVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKAT
LVEHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALA
FQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEAS
FEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMR
YGSRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMF
QAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMST
QAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDII
VIGNDITYLIGSFGPQEDLLFLRASELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAW
VDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLR
GSGMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVL
GREVYTSNNQLGGIQIMHNNGVTHSIVCDDFEGVFTVLHWLSYMPKNVHSLVPLLNSKDP
IDRIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARL
GGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGL
PLMVFANWRGFSGGMKDMYDQVLKFGAYIVDSLRECSQPVLVYIPPQAELRGGSWVVIDP
TINPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSA
AERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWR
LRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQL
TEEDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRIL
STMDSPST
NT seq 7047 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccatcccccttggccaaacctctggagctgaaccagcactctcggttcata
attggttctgtatctgaagataactcagaggatgaaatcagcaacctagtgaagctggac
ctactggaggagaaggaaggctctctgtcaccagcttctgttggctcagatacgctctct
gatttggggatttccagcctacaggatggcttggccttgcacatgaggtccagcatgtct
ggcttgcatctagtaaagcaaggtcgagaccgaaagaaaatagactcacagcgagatttc
actgtagcttcaccagcagaatttgttacgcgttttggggggaataaagtgattgagaag
gttcttattgccaacaatggcatcgcagcagtgaaatgcatgcggtccatccgccgatgg
tcttatgagatgtttcgaaatgaacgtgcaatccgatttgttgttatggtcacacctgaa
gacctgaaagccaatgcagaatacattaagatggcagatcactatgtgccggtgccagga
ggaccaaacaacaacaactatgcaaacgtggaattaattcttgatattgctaaaaggatc
ccagtacaagcagtgtgggctggctggggtcatgcttctgagaatcccaagctcccagaa
cttcttttgaaaaatggcatcgccttcatgggtcctccaagccaggccatgtgggctttg
ggggataagattgcatcttccatagtggctcaaactgctggtatcccaactcttccctgg
agtgggagtggtcttcgtgtggactggcaggaaaatgatttttcaaaacgtatcttaaat
gttccccaggaattatatcaaaaaggttatgtgaaggatgtggatgatgggctgaaggca
gcagaggaagttggatatccagtaatgatcaaggcctcagaaggaggaggagggaaagga
atcagaaaagttaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaa
gtccctggatctcctatatttgtgatgagattagccaaacaatcccgtcatctggaggta
cagattttagcagatcagtacggcaatgctatctctctgtttggtcgtgactgctctgtg
cagcgcaggcatcagaagattattgaagaagcaccagctgctattgctactccagcagta
ttcgaacatatggaacagtgtgcggtgaaacttgccaaaatggttggttatgtgagtgca
gggactgtcgaatacctctacagccaggatggaagcttctactttctggaactgaaccct
cggctacaggtggagcacccttgtacagagatggtggctgatgtcaacctccctgcagcg
caactccagattgccatggggatccctctgtatagaatcaaggatattcgtatgatgtat
ggagtatctccctggggtgatgctcccattgattttgaaaattctgctcatgttccttgc
ccaaggggccatgttattgctgctcggatcactagtgaaaatccagatgagggttttaag
cccagctcaggaacagttcaggaactgaatttccgtagcaataagaatgtttggggttat
ttcagtgttgctgctgcagggggccttcacgaatttgctgattctcagtttggtcactgc
ttctcctggggagaaaacagagaggaagcaatttcaaacatggtggtggctttgaaggag
ctatctattcggggtgactttcgaactacagttgaatacctcatcaaattgctggagact
gagagttttcagctgaatagaattgacactggctggctagacagactgatagcagaaaaa
gtacaggcagagcgacctgataccatgttgggagttgtgtgtggggctctccacgtggca
gatgtgagcctacggaatagcatctctaacttccttcattccttagaaaggggtcaagtt
cttcctgctcatacgcttctgaatacagtagatgttgaacttatctatgagggagtcaaa
tatgtacttaaggtgactcgacagtcccccaactcgtatgtggtgatcatgaacggctca
tgcgtagaagtagatgtgcatcggctgagtgatggagggctgctcctgtcctatgatggc
agcagttataccacatacatgaaggaggaagtggatagatatcgtatcacaattggcaat
aagacctgtgtgtttgagaaggaaaatgacccttcagtgatgcgctcaccttctgctggg
aagttaatccagtatattgtggaggatggaggccatgtgttttctggccagtgctatgct
gagattgaggtgatgaagatggtaatgaccttaacagcagcagagtctggctgtatccat
tatgtcaaacggcctggagcagctcttgaccctggctgtgtgatagccaaaatgcagtta
gacaaccccagcaaggtccaacaggctgagcttcacacgggtagtctgccacggatccag
agcacagcactgagaggcgagaagctccatcgagtgttccattatgtcctggataatctg
gtcaacgtaatgaatggatactgccttccagatcctttttttagtagcagggtaaaagac
tgggtagagcggttgatgaagaccctcagagatccctccttgcctctcctagaattgcaa
gatatcatgaccagtgtctctggccgtattcccccgaatgtggagaagtctatcaagaag
gaaatggctcagtatgccagcaacatcacatcagtcctctgtcagtttcccagccagcag
attgccaacatcctagatagccatgcagctacattgaaccggaaatctgaacgggaagtt
ttcttcatgaacacccagagcattgtccagctggtacagaggtaccgaagtggcatccga
ggccacatgaaggctgttgtgatggatctgctacggcagtacctacgagtagagacacag
ttccagaatggtcactatgacaaatgtgtgtttgcccttcgagaagagaacaagagtgac
atgaacactgtgctaaactatatcttctctcatgctcaagtcaccaagaagaatcttctg
gtcacaatgcttattgatcagttgtgtggtcgggaccctactctcactgatgagctgctg
aatatcctcacagagctaactcaactcagtaagaccaccaatgccaaagtggcacttcga
gcacgccaggttcttattgcctcccatttgccatcatatgagcttcgccataaccaagta
gagtctatcttcctttcagctattgacatgtatggacatcagttttgcattgagaacctg
cagaaactcatcttgtctgaaacatctatttttgatgtcctaccaaacttcttctatcac
agcaaccaggtagtgaggatggcagctctggaggtttatgttcgaagggcttacattgcc
tatgaacttaacagcgtccaacatcgccagcttaaggacaatacctgcgtggtggaattc
cagttcatgctgcccacatcgcatccaaacagagggaacatccccacgctaaacagaatg
tccttctcctccaacctcaaccactatggcatgactcacgtagctagtgtcagcgatgtg
ctgttggacaactcattcactccaccgtgtcagcggatgggcggaatggtctcttttcgg
actttcgaagattttgtcaggatctttgatgaagtgatgggctgcttctgtgactcccca
ccccaaagccccacgttccctgaggcaggtcacacatctctgtatgatgaagacaagttt
caggtccccagggatgaaccaattcacattctgaatgtggctatcaagactgactgtgat
attgaggatgacagactggcagctatgttcagagagtttacccaacaaaataaagctacc
ctggttgagcatgggatacggcgccttactttcctggtcgcacaaaaggatttcagaaaa
caggtcaactatgaggtggatcagagatttcatagagaatttcctaaatttttcacgttc
cgagcaagggataagtttgaggaggatcgtatctatcgtcacctggagcctgccctagct
ttccagttagaactgaaccggatgagaaattttgaccttactgccattccatgtgctaat
cataagatgcacctgtatcttggggcagccaaggtggaagtgggcactgaagtgacagac
tataggttctttgttcgtgcaatcatcagacattctgatctggtcaccaaggaagcttct
tttgaatatctacaaaatgaaggggagcggctgctcctggaggccatggatgaattggaa
gttgcttttaataatacaaatgttcgcactgactgcaaccacatcttcctcaactttgtg
cccacagtcattatggacccatcaaagattgaggaatctgtgcggagcatggtaatgcgc
tatggaagtcggctgtggaaattacgtgtcctccaggcagaactgaaaatcaacattcgc
ctgacaccaactggaaaagcaattcccatccgcctcttcctgacaaatgagtccggctat
tacttggacatcagcttgtacaaggaagtgactgactccaggacagcacagatcatgttt
caggcatatggagacaaacagggaccattgcatggaatgttaatcaacactccatatgtc
accaaagacctacttcaatcaaagagattccaggcacaatccttggggacaacatacata
tatgatatcccagagatgtttcggcagtctctgatcaaactctgggagtctatgtccact
caagcattccttccatcaccccccctgccttctgacatgctaacgtatactgagcttgtg
ttggatgatcagggccagctggtccacatgaacaggcttccaggaggaaatgagattggc
atggtagcttggaaaatgacccttaaaagtcctgaatatccagaaggccgagatatcatt
gttattggcaatgacatcacatacctgattgggtcctttgggccccaggaggatttgctg
tttctcagagcttctgagcttgccagggcagagggtatcccacgcatctttgtcgcagcc
aacagcggagcacgaattggactggcagaggaaattcgtcatatgtttcacgtggcctgg
gtagatcctgaggatccttacaagggatacaaatacttatatctgacccctcaggattat
aagagggtcagtgctctcaactctgtccactgtgaacatgtagaagatgaaggagaatcc
aggtacaagataactgatattattgggaaggaagagggacttggagcagagaaccttcga
ggctctggaatgattgctggagaatcctcattggcctataatgagattatcaccatcagc
ttggttacatgccgggctattgggattggagcttaccttgtccggctgggacagagaacc
atccaggttgaaaattctcacttaattctgaccggagctggagctctcaacaaagtcctt
gggcgggaagtatacacctccaataaccagcttgggggcatccagatcatgcacaacaat
ggggtgacccacagcatcgtttgtgatgactttgaaggggttttcactgtcctacactgg
ctgtcttacatgcctaagaatgtgcacagtttagtacctctcctgaactccaaggatccg
atagatagaatcatcgaatttgttcctacgaaggccccctatgatcctcgatggatgcta
gcaggccgtcctcacccaacccagaaaggtcagtggttgagtggattctttgactatgga
tctttctctgaaatcatgcaaccctgggcacagactgttgtggttggcagagccaggcta
ggaggaatacctgtaggagtagttgctgtagaaacccgaacagtggaactaagtatccca
gccgaccctgcaaacctggattctgaagccaagataatccagcaggctggccaggtttgg
tttccagattctgcgtttaagacctatcaggctatcaaggacttcaaccgtgaagggctg
cctctgatggtctttgccaactggagaggcttctccggtgggatgaaagatatgtacgac
caggtgctgaagtttggtgcttacatcgtggatagcttacgggagtgctcccagcctgtg
ctggtttacattcctcctcaagctgagctccggggtggctcctgggttgtgattgacccc
accatcaacccccggcacatggagatgtacgctgaccgagaaagcaggggatcagttctg
gagccagaagggacagtagaaatcaaattccgcagaaaagatctggtgaaaaccatgcgt
cgggtggacccagtctacattcgcttggctgaacgattgggcaccccagagctaagcgca
gctgagcggaaggagctggagaacaagttgaaggagcgggaggaattcctaattcccatt
taccatcaggtagccgtgcagtttgctgacttgcacgacacaccaggccggatgcaggag
aagggtgttattaacgacatcctggattggaaaacatcccgtaccttcttctactggcgg
ctgaggcgtctcctgctggaggacctggtcaaaaagaaaatccacaatgccaacccagag
ctcactgatggtcagatccaggccatgttaaggcgctggtttgtagaagtggaaggaacc
gtgaaggcctatgtttgggacaataacaaggatctagtggagtggctggagaaacagctg
accgaagaagatggtgttcgctcagtaatcgaggaaaacatcaaatacatcagcagagac
tatgtcctcaagcagatccgcagcttggtacaggccaatcccgaggttgccatggattcc
atcgtccatatgacccagcacatctcacccactcagcgagcagaagtcgtacggatcctc
tccacgatggactccccttcaacatag

DBGET integrated database retrieval system