KEGG   Felis catus (domestic cat): 101083046Help
Entry
101083046         CDS       T02385                                 

Gene name
ACACA
Definition
acetyl-CoA carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
fca  Felis catus (domestic cat)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fca01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fca00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:fca00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:fca00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:fca04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 2383 aa AA seqDB search
MWWSTLMSILRASSFWRWISAQTVRIIRALRAHFEGIMDEPSPLAKPLELNQHSRFIIGS
VSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDLGISSLQDGLALHMRSSMSGLH
LVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYE
MFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQ
AVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGS
GLRVDWQENDFSKRILNVPQELYQKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRK
VNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRR
HQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQ
VEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRG
HVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSW
GENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQA
ERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYEGVKYVL
KVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTC
VFEKENDPSVMRSPSAGKLIQYIVEDGGHVFSGQCYAEIEVMKMVMTLTAAESGCIHYVK
RPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNV
MNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPPNVEKSIKKEMA
QYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHM
KAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTM
LIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESI
FLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYEL
NSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHYGMTHVASVSDVLLD
NSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEAGHTSLYDEDKVPRD
EPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNYE
VDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDIIVIGNDITYLIGSFGPQEDLLFLRAS
ELARAEGIPRIFVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSA
LNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYNEIITISLVTCR
AIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHS
IVCDDFEGVFTVLHWLSYMPKNVHSLVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGRPH
PTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPAN
LDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDSLRECSQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADRESRGSVLEPEGT
VEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSAAERKELENKLKEREEFLIPIYHQVA
VQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQ
IQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTEEDGVRSVIEENIKYISRDYVLKQ
IRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPST
NT seq 7152 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtccactctgatgtcaatcttgagggctagttctttttggaggtggatatct
gctcagacagtaagaattataagagctctgagagctcattttgaaggaataatggatgaa
ccatcccccttggccaaacctctggagctgaaccagcactctcggttcataattggttct
gtatctgaagataactcagaggatgaaatcagcaacctagtgaagctggacctactggag
gagaaggaaggctctctgtcaccagcttctgttggctcagatacgctctctgatttgggg
atttccagcctacaggatggcttggccttgcacatgaggtccagcatgtctggcttgcat
ctagtaaagcaaggtcgagaccgaaagaaaatagactcacagcgagatttcactgtagct
tcaccagcagaatttgttacgcgttttggggggaataaagtgattgagaaggttcttatt
gccaacaatggcatcgcagcagtgaaatgcatgcggtccatccgccgatggtcttatgag
atgtttcgaaatgaacgtgcaatccgatttgttgttatggtcacacctgaagacctgaaa
gccaatgcagaatacattaagatggcagatcactatgtgccggtgccaggaggaccaaac
aacaacaactatgcaaacgtggaattaattcttgatattgctaaaaggatcccagtacaa
gcagtgtgggctggctggggtcatgcttctgagaatcccaagctcccagaacttcttttg
aaaaatggcatcgccttcatgggtcctccaagccaggccatgtgggctttgggggataag
attgcatcttccatagtggctcaaactgctggtatcccaactcttccctggagtgggagt
ggtcttcgtgtggactggcaggaaaatgatttttcaaaacgtatcttaaatgttccccag
gaattatatcaaaaaggttatgtgaaggatgtggatgatgggctgaaggcagcagaggaa
gttggatatccagtaatgatcaaggcctcagaaggaggaggagggaaaggaatcagaaaa
gttaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaagtccctgga
tctcctatatttgtgatgagattagccaaacaatcccgtcatctggaggtacagatttta
gcagatcagtacggcaatgctatctctctgtttggtcgtgactgctctgtgcagcgcagg
catcagaagattattgaagaagcaccagctgctattgctactccagcagtattcgaacat
atggaacagtgtgcggtgaaacttgccaaaatggttggttatgtgagtgcagggactgtc
gaatacctctacagccaggatggaagcttctactttctggaactgaaccctcggctacag
gtggagcacccttgtacagagatggtggctgatgtcaacctccctgcagcgcaactccag
attgccatggggatccctctgtatagaatcaaggatattcgtatgatgtatggagtatct
ccctggggtgatgctcccattgattttgaaaattctgctcatgttccttgcccaaggggc
catgttattgctgctcggatcactagtgaaaatccagatgagggttttaagcccagctca
ggaacagttcaggaactgaatttccgtagcaataagaatgtttggggttatttcagtgtt
gctgctgcagggggccttcacgaatttgctgattctcagtttggtcactgcttctcctgg
ggagaaaacagagaggaagcaatttcaaacatggtggtggctttgaaggagctatctatt
cggggtgactttcgaactacagttgaatacctcatcaaattgctggagactgagagtttt
cagctgaatagaattgacactggctggctagacagactgatagcagaaaaagtacaggca
gagcgacctgataccatgttgggagttgtgtgtggggctctccacgtggcagatgtgagc
ctacggaatagcatctctaacttccttcattccttagaaaggggtcaagttcttcctgct
catacgcttctgaatacagtagatgttgaacttatctatgagggagtcaaatatgtactt
aaggtgactcgacagtcccccaactcgtatgtggtgatcatgaacggctcatgcgtagaa
gtagatgtgcatcggctgagtgatggagggctgctcctgtcctatgatggcagcagttat
accacatacatgaaggaggaagtggatagatatcgtatcacaattggcaataagacctgt
gtgtttgagaaggaaaatgacccttcagtgatgcgctcaccttctgctgggaagttaatc
cagtatattgtggaggatggaggccatgtgttttctggccagtgctatgctgagattgag
gtgatgaagatggtaatgaccttaacagcagcagagtctggctgtatccattatgtcaaa
cggcctggagcagctcttgaccctggctgtgtgatagccaaaatgcagttagacaacccc
agcaaggtccaacaggctgagcttcacacgggtagtctgccacggatccagagcacagca
ctgagaggcgagaagctccatcgagtgttccattatgtcctggataatctggtcaacgta
atgaatggatactgccttccagatcctttttttagtagcagggtaaaagactgggtagag
cggttgatgaagaccctcagagatccctccttgcctctcctagaattgcaagatatcatg
accagtgtctctggccgtattcccccgaatgtggagaagtctatcaagaaggaaatggct
cagtatgccagcaacatcacatcagtcctctgtcagtttcccagccagcagattgccaac
atcctagatagccatgcagctacattgaaccggaaatctgaacgggaagttttcttcatg
aacacccagagcattgtccagctggtacagaggtaccgaagtggcatccgaggccacatg
aaggctgttgtgatggatctgctacggcagtacctacgagtagagacacagttccagaat
ggtcactatgacaaatgtgtgtttgcccttcgagaagagaacaagagtgacatgaacact
gtgctaaactatatcttctctcatgctcaagtcaccaagaagaatcttctggtcacaatg
cttattgatcagttgtgtggtcgggaccctactctcactgatgagctgctgaatatcctc
acagagctaactcaactcagtaagaccaccaatgccaaagtggcacttcgagcacgccag
gttcttattgcctcccatttgccatcatatgagcttcgccataaccaagtagagtctatc
ttcctttcagctattgacatgtatggacatcagttttgcattgagaacctgcagaaactc
atcttgtctgaaacatctatttttgatgtcctaccaaacttcttctatcacagcaaccag
gtagtgaggatggcagctctggaggtttatgttcgaagggcttacattgcctatgaactt
aacagcgtccaacatcgccagcttaaggacaatacctgcgtggtggaattccagttcatg
ctgcccacatcgcatccaaacagagggaacatccccacgctaaacagaatgtccttctcc
tccaacctcaaccactatggcatgactcacgtagctagtgtcagcgatgtgctgttggac
aactcattcactccaccgtgtcagcggatgggcggaatggtctcttttcggactttcgaa
gattttgtcaggatctttgatgaagtgatgggctgcttctgtgactccccaccccaaagc
cccacgttccctgaggcaggtcacacatctctgtatgatgaagacaaggtccccagggat
gaaccaattcacattctgaatgtggctatcaagactgactgtgatattgaggatgacaga
ctggcagctatgttcagagagtttacccaacaaaataaagctaccctggttgagcatggg
atacggcgccttactttcctggtcgcacaaaaggatttcagaaaacaggtcaactatgag
gtggatcagagatttcatagagaatttcctaaatttttcacgttccgagcaagggataag
tttgaggaggatcgtatctatcgtcacctggagcctgccctagctttccagttagaactg
aaccggatgagaaattttgaccttactgccattccatgtgctaatcataagatgcacctg
tatcttggggcagccaaggtggaagtgggcactgaagtgacagactataggttctttgtt
cgtgcaatcatcagacattctgatctggtcaccaaggaagcttcttttgaatatctacaa
aatgaaggggagcggctgctcctggaggccatggatgaattggaagttgcttttaataat
acaaatgttcgcactgactgcaaccacatcttcctcaactttgtgcccacagtcattatg
gacccatcaaagattgaggaatctgtgcggagcatggtaatgcgctatggaagtcggctg
tggaaattacgtgtcctccaggcagaactgaaaatcaacattcgcctgacaccaactgga
aaagcaattcccatccgcctcttcctgacaaatgagtccggctattacttggacatcagc
ttgtacaaggaagtgactgactccaggacagcacagatcatgtttcaggcatatggagac
aaacagggaccattgcatggaatgttaatcaacactccatatgtcaccaaagacctactt
caatcaaagagattccaggcacaatccttggggacaacatacatatatgatatcccagag
atgtttcggcagtctctgatcaaactctgggagtctatgtccactcaagcattccttcca
tcaccccccctgccttctgacatgctaacgtatactgagcttgtgttggatgatcagggc
cagctggtccacatgaacaggcttccaggaggaaatgagattggcatggtagcttggaaa
atgacccttaaaagtcctgaatatccagaaggccgagatatcattgttattggcaatgac
atcacatacctgattgggtcctttgggccccaggaggatttgctgtttctcagagcttct
gagcttgccagggcagagggtatcccacgcatctttgtcgcagccaacagcggagcacga
attggactggcagaggaaattcgtcatatgtttcacgtggcctgggtagatcctgaggat
ccttacaagggatacaaatacttatatctgacccctcaggattataagagggtcagtgct
ctcaactctgtccactgtgaacatgtagaagatgaaggagaatccaggtacaagataact
gatattattgggaaggaagagggacttggagcagagaaccttcgaggctctggaatgatt
gctggagaatcctcattggcctataatgagattatcaccatcagcttggttacatgccgg
gctattgggattggagcttaccttgtccggctgggacagagaaccatccaggttgaaaat
tctcacttaattctgaccggagctggagctctcaacaaagtccttgggcgggaagtatac
acctccaataaccagcttgggggcatccagatcatgcacaacaatggggtgacccacagc
atcgtttgtgatgactttgaaggggttttcactgtcctacactggctgtcttacatgcct
aagaatgtgcacagtttagtacctctcctgaactccaaggatccgatagatagaatcatc
gaatttgttcctacgaaggccccctatgatcctcgatggatgctagcaggccgtcctcac
ccaacccagaaaggtcagtggttgagtggattctttgactatggatctttctctgaaatc
atgcaaccctgggcacagactgttgtggttggcagagccaggctaggaggaatacctgta
ggagtagttgctgtagaaacccgaacagtggaactaagtatcccagccgaccctgcaaac
ctggattctgaagccaagataatccagcaggctggccaggtttggtttccagattctgcg
tttaagacctatcaggctatcaaggacttcaaccgtgaagggctgcctctgatggtcttt
gccaactggagaggcttctccggtgggatgaaagatatgtacgaccaggtgctgaagttt
ggtgcttacatcgtggatagcttacgggagtgctcccagcctgtgctggtttacattcct
cctcaagctgagctccggggtggctcctgggttgtgattgaccccaccatcaacccccgg
cacatggagatgtacgctgaccgagaaagcaggggatcagttctggagccagaagggaca
gtagaaatcaaattccgcagaaaagatctggtgaaaaccatgcgtcgggtggacccagtc
tacattcgcttggctgaacgattgggcaccccagagctaagcgcagctgagcggaaggag
ctggagaacaagttgaaggagcgggaggaattcctaattcccatttaccatcaggtagcc
gtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgttattaac
gacatcctggattggaaaacatcccgtaccttcttctactggcggctgaggcgtctcctg
ctggaggacctggtcaaaaagaaaatccacaatgccaacccagagctcactgatggtcag
atccaggccatgttaaggcgctggtttgtagaagtggaaggaaccgtgaaggcctatgtt
tgggacaataacaaggatctagtggagtggctggagaaacagctgaccgaagaagatggt
gttcgctcagtaatcgaggaaaacatcaaatacatcagcagagactatgtcctcaagcag
atccgcagcttggtacaggccaatcccgaggttgccatggattccatcgtccatatgacc
cagcacatctcacccactcagcgagcagaagtcgtacggatcctctccacgatggactcc
ccttcaacatag

DBGET integrated database retrieval system