KEGG   Felis catus (domestic cat): 101083122Help
Entry
101083122         CDS       T02385                                 

Gene name
USP43
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 43
  KO
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101083122 (USP43)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101083122 (USP43)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101083122 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
E1
AA seq 1123 aa AA seqDB search
MEPGAGAAAGEGPPAPRPRRRRRSLRRLLGRFLLALSSRSRPGASPPRPRPGPREGDGEG
GFAPPGPAPAARGSPGERRAAGPQPQAPAGDGARPPGAQGXKNHGNTCFMNAVVQCLSNT
DLLAEFLALGRYRAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQGNA
QHDALEFLLWLLDRVHEDLEVSSRGPGSEKPQPEASRTPEHLLSPSAQLPLGQSFVQSHF
QAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRVGLAVPI
LSTVASLRKMVAEEGGVPADEVILVELCPSGFQRSFFDEEDLNTIAEGDNVYAFHAPPPP
GQEMLSAHPPGLSISPRLAAHGGQRLPPPVQSENKVLILLCNLAGSGQQASRFGPPFLIR
EDRAISWVQLQQCILSKVRYLMKSEAPLQNPGSLFSIRVVGLSLACSYLSPQDSHPLSHW
AVDRALHPRRPGGPPHVKLAVEWDSDAKGRLFGSPQEERVQDAESVWRQQEAHQQPSCTL
DECFQFYTKEEQLAQDDAWKCPHCKALQQGTVKLSLWTLPDILIIHLKRFCQVGERRNKL
STLVKFPLSGLNMAPHVAQRNAGPKPATGPWPSWEQPACLPASCPWDFLYDLYAVCNHHG
GLQGGHYTAYCRNSLDGQWYSFDDSTVEPLPEDEVSTRGAYILFYQKRNSIPPWSASGSM
RGSTSSSFSDHWLLRLGSSNSSARGSLLSWSSSPGPSRPPAPDPPVFNATRLAYSESGEL
GSRRLVRGVRGRSISMKEPAPSRAKQGAFKTLPLRWSFRPREKPPGTSVELVEYLESRRR
PRPTSQSIVPLLTGAACEDGKSAEGEDGGPASETVLARAPCPSGHPSPCAAPGTSDGLNT
ARKAKENASQDIRLPRRFDLPLTVMPSGPNEKRARPEGQKTANCKGSGQAGSLSTAPSPT
EALSRTELSRNSAESRQNTRIRMRANVDGRDVPQGTLTLLRSVFSKKENKSERPDVAPQA
SPVSLVSGRLSPAVDEHSRGSSPSLRIQESLARAPITHLERDVWSAPSSLRLPRKAVRST
RASALGTSQRTVPGEHTPLGTLQKVKYHTLSLSRKKTLPESSF
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggcgcgggggccgcggcgggagaggggccgcccgcgccccggccccgccgc
cgccgccgctccctgcgtcgcctgctcggccgcttcctgctggcgctgagcagccgctcc
cgcccgggggcctcgccgccccggccccggccgggaccccgcgaaggcgacggcgagggg
ggcttcgcgcccccgggccccgccccagccgcgcgcgggagccccggggagcggcgcgcg
gccggcccccagccccaggcccccgccggcgacggcgcgcggcccccgggcgcgcagggc
ntgaagaaccacggcaacacctgtttcatgaacgccgtggtgcagtgtctcagcaacacc
gacctgctggccgagttcctggcgctggggcgctaccgggcggcgccgggccgcgccgag
gtcaccgagcagctggcggcgctggtgcgcgcgctctggacgcgcgagtacacgccccaa
ctttccgccgagttcaagaatgctgtttccaagtacggctctcagttccaaggcaatgcc
cagcacgacgccctggagttcctgctctggcttctggaccgtgtgcacgaggacctggaa
gtctcctcccgagggcccgggtccgagaagcctcagcctgaagccagcagaacccctgag
cacctcctgtccccatcggctcagcttcccctaggccaaagctttgtgcaaagccacttt
caagcccagtatagatcttccttgacctgtccccactgcctgaaacagagcaacaccttc
gatcctttcctgtgtgtgtcactacctatccccttgcgccagacaagattcttgagcgtc
acgttggtcttcccctcgaagagccagcggttcctgcgggttggcctggccgtgccaatc
ctcagcacagtggcatccctgaggaagatggtcgcagaggaaggcggtgtccctgcggat
gaggtgatcttagttgaactgtgtcccagtggattccagcggtctttctttgatgaagag
gacctgaataccattgcagagggagataatgtatatgccttccacgcccctccaccacct
ggccaggagatgctctcggctcacccacctggtctttccatctccccgcgcttggcagcc
catgggggtcaacggttacccccgcctgtccagagtgagaacaaggtgctgatcctcctc
tgtaacttggcggggtctgggcagcaggccagcaggtttgggccacctttcctgatacgg
gaagacagagccatttcctgggtccagctccaacaatgcattctcagtaaggtccgctat
ctcatgaagagtgaggcccccctccagaacccggggtctctgttctccatccgggtggtg
gggctttctctggcctgcagctacttatccccccaggacagccatcccctcagtcactgg
gcagttgacagggctctgcaccccaggaggccaggaggccccccgcacgtcaaactggcc
gtggagtgggacagtgatgccaaggggcgcctgttcgggagcccccaggaggagcgggtc
caggacgcggagagcgtgtggcggcagcaggaggcgcaccagcaacccagctgcaccctg
gacgagtgctttcagttctacaccaaggaggagcagctggctcaggacgatgcgtggaag
tgtccacactgcaaggccctccagcagggcacggtgaaactgagtctctggaccctgcct
gacatcctcatcatccacctgaaaaggttctgtcaggtgggcgagaggagaaacaagctg
tccacgctggtgaagtttccgctctccggcctcaacatggccccccacgtggcccagaga
aacgcgggccccaagcccgcgacaggcccctggccttcctgggagcagccggcctgcctg
cccgccagctgcccgtgggacttcctgtacgacttgtatgccgtctgcaaccaccacggc
ggtctgcaaggtgggcattacacagcctactgccggaactctctggacggccagtggtac
agttttgatgacagcacagtggaaccgctcccggaagatgaggtcagtacgcgaggggct
tacatcctgttttatcagaaacggaacagcatccccccctggtcagccagcggttccatg
agaggttccaccagctcctccttctccgatcactggctccttcgactcgggagcagtaac
agcagtgcgagggggagcctgctgtcctggagctccagccccggcccctcccggcccccg
gcgcctgaccctcccgtcttcaacgcgacacgccttgcttactccgaatcaggagagctg
gggtccaggcgtctggtacggggcgtacgaggccgaagcatcagcatgaaggagcctgcg
ccttccagagccaagcagggagccttcaagaccttgcccctccgctggtctttcagaccc
agggagaaaccgcccggtacatctgtcgagctggtggagtacttggagtccaggcggagg
ccccgacccaccagccagtccatcgtgccgctgttgacgggcgctgcctgcgaggacggg
aagtccgctgagggtgaagacggcgggccagccagtgagacagtgctggcccgagcgccc
tgcccctcaggccaccccagtccctgtgcagcccccggaacctcagatggcctgaataca
gccaggaaagccaaggaaaatgcgagtcaggatatcaggctccccagacggtttgacctg
cccctcacggtgatgccctcagggccgaatgagaaacgagccaggccggagggccagaag
acggcgaactgcaagggaagtggccaggcaggaagcctcagcacagcaccctcccccaca
gaggcgctgagccgcacggaattatctaggaacagtgcagagagccgccagaatacccgc
atcagaatgagggctaatgtggacggcagggacgtcccacaggggaccctcacccttctg
aggtccgtgttttccaagaaggagaacaaatctgagaggccagacgtggccccccaggcg
tcccccgtgtccctggtgagcggcaggctgagcccggctgtggatgagcactctcggggc
tcctctccttccctccggattcaggagagcctggccagagcccccatcacccacttggag
agggatgtatggtcggctcccagctctctccgcctccctcgcaaagccgtcaggtccacg
agggccagtgccctgggcacgtcccagaggactgtcccaggggaacacactcctttgggc
accttgcaaaaggtgaaataccacactctttccttgagtcggaagaaaacgttacccgag
tccagcttttga

DBGET integrated database retrieval system