KEGG   Felis catus (domestic cat): 101083135Help
Entry
101083135         CDS       T02385                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A1
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcagcgttggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctacatcctaactggcagtttgttgatgtatatggaatggatcctgaa
cttcttagcatggtaccaagaccagtgtgtgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacggaggaggaggaaaaaataaagtctcagggacaagatgtt
acgtcatcagtatatttcatgaagcaaacaatcagcaatgcctgcggaacaattggactc
atccatgctattgccaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctagaggagtctgtgtcaatgagccctgaagaacgagccagatacctagagaac
tatgacgctatccgagtcactcatgagaccagtgcccatgaaggtcagactgaggcacca
agtatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatggacggaaaccatttccaattaaccatggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaattg
aggttcaatgcaattgctctatctgcagcatag

DBGET integrated database retrieval system