KEGG   Felis catus (domestic cat): 101083135Help
Entry
101083135         CDS       T02385                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101083135 (UCHL3)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101083135 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A1
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcagcgttggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctacatcctaactggcagtttgttgatgtatatggaatggatcctgaa
cttcttagcatggtaccaagaccagtgtgtgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacggaggaggaggaaaaaataaagtctcagggacaagatgtt
acgtcatcagtatatttcatgaagcaaacaatcagcaatgcctgcggaacaattggactc
atccatgctattgccaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctagaggagtctgtgtcaatgagccctgaagaacgagccagatacctagagaac
tatgacgctatccgagtcactcatgagaccagtgcccatgaaggtcagactgaggcacca
agtatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatggacggaaaccatttccaattaaccatggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaattg
aggttcaatgcaattgctctatctgcagcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system