KEGG   Felis catus (domestic cat): 101083327Help
Entry
101083327         CDS       T02385                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101083327 (USP4)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101083327 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A2
AA seq 964 aa AA seqDB search
MAEGGGCRERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRN
FPTSPTSSASPYSSVSASSIANGDSTNTSGMHSSGVSRGGSAFSASYNCQESPSSHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEVFLVPADPCCRPTQYRVVVPLMGAVSDLCEALSRLSGIAAENMVVTDVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSADGSECVTLPVYFRERKSRPSSTSSGAVL
YGQPLLVSVPKHKLTLESLYQAVCERISRYIKQPLPDESGSSPLEPGACNGSRGSCEGED
EEEMEHQDEGREQLSDTEGSGEDELGNDCGETTQKKVKGQSCPKRLFTFSLVNSYGTADI
NSLATDGKLLKLNSRSTLAIDWDSETRSLYYDEQESEAYEKHVSMLQPQKKKKTAVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPVRALNMSEFVCDLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLISFSGSSEGGTSPSSSQQGMGDDEACS
MDTN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggctgccgtgagcgaccggatgcggagacccagaaatcggagctc
ggggccttgatgaggaccacgctccaacgaggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggcttcgacagctgggatatgtacaatgtgggt
gaacacaatctgtttcctggcccaatagataactctggactcttttcagatccggagagt
cagaccttgaaagaacatttaattgatgaattggattatgtattggtcccaaccgaggcc
tggaataaattactcaactggtatggctgtgtagaaggccagcagcccattgtcagaaaa
gttgtggagcacggcctgtttgtcaaacactgcaaagtggaggtatatttgctggaactg
aagctctgtgagaacagtgaccccaccaatgtgctgagttgccatttcagcaaggcagac
accattgcaaccatcgagaaggagatgcggaagctgttcaacatccctgctgagcgtgaa
acacggctgtggaacaaatacatgagcaacacttacgagcagctgagcaagctagacaac
actgtccaggatgcggggctgtaccagggtcaggtgctagtaattgagccccaaaatgaa
gatggcacatggccgaggcagaccttgcagtcaaaatcaagcactgcacctagcagaaat
tttcctacctctccaacatcatcagcaagtccctattcctcagtgtctgcctcttccatt
gcaaatggtgatagcactaacacctctgggatgcacagttccggtgtcagcaggggtgga
tctgccttctctgcttcgtataattgtcaggagtccccatcgtctcacatacagcctggg
ctctgcggacttggaaacctggggaacacttgcttcatgaactctgctttacagtgcttg
agcaacaccgcaccactgactgactactttctcaaagatgagtatgaggctgagatcaac
agagacaatcctctgggaatgaaaggggaaattgcagaagcctatgcagagctcattaaa
cagatgtggtctggaagggatgctcacgtggcacctcgcatgttcaaaacccaagtggga
cgtttcgcccctcagttttctggctaccagcaacaagactctcaggagttgttagccttt
cttctagatggattgcatgaagatctgaaccgtgtaaagaagaagccctacctggagctg
aaggatgccaatgggcgaccagatgcggtggtggcaaaggaagcctgggagaatcacagg
ttgaggaatgactctgtgattgtggacacattccatggcctcttcaaatctactttggtt
tgcccagaatgtgctaaggtttctgtgacctttgacccattttgctatctaactctccca
ctgcccctgaagaaagatagagttatggaggtcttcctggttcctgctgacccttgctgc
agacctactcagtaccgcgtggttgtgccgctgatgggggctgtgtctgacctgtgcgag
gctctctccaggctgtctggcattgctgcagaaaacatggtggtcacagatgtatataat
caccggttccacaaaattttccaaatggatgaaggtttaaaccacatcatgcctcgggat
gacatttttgtgtacgaggtctgcagcacctccgctgatggctctgagtgtgtcacactt
ccagtctacttcagggaaaggaagtccaggccgtcgagcacttcttccggggcagtgctg
tatggacagccactgctggtttctgttcccaagcacaagctaacccttgagtctttgtac
caggctgtttgtgagcgtatcagccgctatataaaacagcctttgcctgatgagtctggc
agctcgcccttggagccgggggcctgcaatggctccaggggcagctgtgaaggagaagat
gaagaagaaatggagcatcaggacgaaggcagagagcaactttcagacacagaaggcagt
ggggaggacgagctgggaaatgactgcggggagaccacccaaaagaaggtcaaaggccag
tcctgcccgaaaaggctttttaccttcagcctcgtgaactcctacggaacagctgatata
aattcccttgcaactgatggaaaactacttaaactcaattctcgatccacactggccatc
gattgggacagtgagacccggagcctttattatgatgagcaagaatctgaggcctatgag
aagcacgtgagcatgttgcagcctcagaagaagaagaagaccgcggtggcgctgagagac
tgcatcgagctcttcaccaccatggagacccttggggagcatgacccctggtactgtccc
aactgtaagaagcatcaacaggccacaaagaagtttgacctgtggtccttgccgaagatc
ctggtggtccacctcaagcgtttctcctacaatagatactggagggataagctcgacacc
gttgtggaattccccgtcagagctctgaacatgtccgagtttgtgtgtgacctgtcagca
aggccttatgtgtacgacctcattgccgtgtctaatcattatggagccatgggggttggc
cactacaccgcatacgcgaagaacaaactgaacgggaaatggtattattttgatgatagc
aatgtgtccctggcctccgaggatcagatagtgacaaaagcagcttacgtgctattttac
caacgtcgagatgatgaattttataagacaccttcactcatcagtttttctggatcctct
gagggagggacgagcccaagcagctcacagcagggcatgggggacgatgaggcttgcagc
atggacaccaactga

DBGET integrated database retrieval system