KEGG   Felis catus (domestic cat): 101083330Help
Entry
101083330         CDS       T02385                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101083330 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101083330 (NCOA3)
   05224 Breast cancer
    101083330 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    101083330 (NCOA3)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101083330 (NCOA3)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101083330 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
A3
AA seq 1412 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTVN
GVAWTNETQRQKSHTFNCRMLMKTPHDILEDINTNPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNANPVGQGIRPPAAGCNSSVGGMSMSPNQGLQMLSGRPYGL
ADPSSTGQMSGPRYGASSTIASMNAGPGMQSPSSYQNSTYGLNMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNISQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLSDKESK
ESSIEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTGSAASGVEG
SVKQEQLSPKKKENNALLRYLLDRDDPSDPLSKELQPKVEGVDNKGSQCSSSAVPSSSQE
KDAKIKTEANEEGSGDLDNLDAILGDLTSSDFYNNSVSTNGSNLGTKQQMFQGTNSLAGL
RSPQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYG
STMGGPNRNVTVNQTASSGDWGLPSSKTSRMEPLSSNSMGRPGADYNASLPRPAVSGSMP
TLPLRSAGIPGARPALPPQQPPQQQMLQMRPGEIPMGVGVSPYGQAAPSNQPGSWPDGML
SVEQGSHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRA
LGIPELVNQGQALESKQDAFQGQEAAVMMDQKAALYGQTYAAQGPPMQGGFNLQGQSPSF
NSMMNQMSQQGSFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKM
ENPTAGGAAVMRPMMQPQVNPQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQ
QQQQTQAFSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQPDAAFGRVSSPP
NAMMPSRMGPSQNPMMQHPQTAPMYQSSEIKGWPSGNLARNSSFPQQPFAHQGNPAAYGM
VHMNGSSGPMGQVNVNPMPMSGMPMGPDQKYC
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaggagaaaactccttggatccactggcccctgattcacgaaaacgcaaa
ttgccatgtgatactccaggacagggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaactggctgaacttatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagatc
cgtcaaataaaagagcaaggaaaagccatttccaatgatgatgatgttcagaaagctgat
gtatcttctacggggcagggagtaattgataaagattccttagggccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataagcaagaagacctggttaacacaagtgtctacagt
atcttgcatgaagaagacagaaaggatttccttaaaaacttaccgaaatctacagtcaat
ggagttgcctggacaaatgagacccagagacaaaaaagccatacttttaattgccgtatg
ctgatgaaaacaccacatgatattctggaagacatcaacactaatcctgaaatgcgccag
agatatgaaacaatgcagtgctttgccctgtctcagcctcgagctatgatggaggaaggg
gaagatttgcaatcctgtatgatctgtgtagcacgtcgcattactacaggcgaaagagcg
tttccctcaaaccccgagagctttattactagacatgatctttcaggaaaagttgtcaat
atagatacaaattcactgagatcttccatgaggcctggttttgaagatattatccgaagg
tgtatccagagattttttagtcttaatgatggtcagtcgtggtcccagaaacgtcactat
caagaagcttatatccatggccacgcagaaaccccggtgtatagattctcattggccgac
ggaaccatagtgactgcacagaccaaaagcaaactcttccgaaaccctgtcacaaacgat
cggcatggctttgtctcgacccactttcttcagagggaacagaatgggtatagaccaaac
gcgaatcctgtcggacaaggcattagacctccagcagctggatgcaacagttcggtaggc
ggcatgagcatgtcgccaaaccaaggcttacagatgctaagcggcaggccctatggcttg
gccgaccccagctccacagggcagatgagtgggcctaggtatggggcttccagcaccata
gcttcaatgaacgctgggccaggcatgcagtccccatcttcctatcagaatagcacctat
ggtctcaacatgagtagccccccacacgggagccctggccttggctccaaccagcagaac
atcatgatttctcctcgtaatcgtgggagtccaaagatggcctcacaccagttttctcct
gttgcaggtgtgcactcgcccatgggatcttctggaaatactgggagccacagcttttct
agtagctctctgagtgctcttcaagccatcagtgagggtgtggggacttctcttttatca
actctgtcttcaccaggccccaaactggataactctcccaatatgaatataagccagcca
agtaaagtgaacagtcaggattccaagagtcccctgggcttgtattgtgatcagaatcca
gtggagagttcaatgtgtcagtcaaatagcagggatcacctcagtgacaaagaaagtaag
gagagcagtatcgaagggtcagagaatcagaggggtcctctggaaagcaaaggtcataaa
aaattactgcagttacttacctgttcttctgatgatcggggtcattcctctttgaccaac
tcccccctggactcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcttcttcgacctctggaggagtgtcctccacatccaatatgcacgggtcactgctgcag
gagaaacaccggatcctgcacaagttgctgcagaatgggaattcacccgcagaagtagcc
aagattaccgcagaagccacggggaaagacaccggtagtgcagcgtctggtgtggaagga
agtgtcaagcaggagcaactgagtcctaagaagaaggagaataatgcacttcttagatac
ctgctggacagggatgatcccagtgatccgctctctaaagaactgcagcccaaagtggaa
ggagtggacaataaagggagtcagtgcagcagctccgccgttcctagctcgagtcaagag
aaagacgctaaaattaagacagaagcaaatgaagagggatctggagatttggataatcta
gatgctattcttggtgatctgactagttctgacttctacaataattccgtatccacaaat
ggtagtaatcttggaaccaagcagcagatgtttcagggaactaattctctggcaggtttg
aggagcccacagtctgtgcagtccattcgtcctccgtataaccgagcggtgtctctagat
agccctgtttctgttggctcgagtcctccagtaaagaatatcagtgctttccccatgtta
ccaaagcagcccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggc
tcaactatgggtggaccaaacagaaatgtgactgtgaatcagactgcttcctcgggagac
tggggcttgccaagctcaaagacgagcagaatggagcctttgagttcaaactccatggga
agaccaggagcggattacaacgcttctttgcccagacctgcagtgagcggctcgatgccc
acgttgccccttcggtccgctggcatcccaggtgcgaggccggcgttgccgccacagcag
ccgccacagcagcagatgcttcaaatgcggcctggtgaaattcccatgggagtgggggtc
agtccgtatggccaggcagcaccgtccaaccagccgggttcctggccagatggcatgttg
tccgtggaacaaggctctcatgggactcaaaataggccacttcttaggaattccctggat
gatcttcttgggccaccttctaacctggaagggcagagtgatgaacgagcgttgttggac
cagctacacactctcttgagcaacacagatgccacaggcttggaagaaattgacagagct
ctgggcatccctgaacttgtgaatcaaggacaagctttggagtccaaacaggatgccttc
caaggccaagaagcggcagtaatgatggatcagaaagcggcattatatgggcagacgtat
gcagcacaggggcctccaatgcaaggaggctttaatcttcagggacaatcaccatctttt
aactccatgatgaatcagatgagccaacaaggcagttttcctctgcaaggaatgcacccg
cgggccaatatcatgagacctcggacaaacacccccaagcaactccgaatgcagcttcag
cagaggctgcagggccagcagtttttgaatcagagccgtcaggcattggaaatgaaaatg
gaaaaccccactgctgggggtgctgcggtgatgaggcccatgatgcagccccaggtaaat
ccccagcagggttttcttaatgcccagatggttgcccagcgcagcagagagctgctcagt
catcacttccgacagcagagggtggccatgatgatgcagcagcagcagcagcagcagcag
cagcagcagcaaacccaggccttcagcccaccccccaacgtgaccgcttcccccagcatg
gatggggtcttggcagggcccgtgatgccacaagcccctccccagcagtttccatacccg
ccaaattatgggatgggacaacagccagatgcggcttttgggcgagtgtctagtcctccc
aatgcaatgatgccctcaagaatggggccctcccagaatcccatgatgcagcacccgcag
accgcgcccatgtatcagtcctcggaaataaaaggctggccatcaggaaacctggccagg
aacagctcctttccccagcagccgtttgcccaccaggggaaccccgcagcatacggtatg
gtgcacatgaatggcagcagtggtcccatgggacaggtgaacgtgaaccccatgcccatg
tctggcatgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system