KEGG   Felis catus (domestic cat): 101083330Help
Entry
101083330         CDS       T02385                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:fca04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A3
AA seq 1443 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTVN
GVAWTNETQRQKSHTFNCRMLMKTPHDILEDINTNPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNANPVGQGIRPPAAGCNSSVGGMSMSPNQGLQMLSGRPYGL
ADPSSTGQMSGPRYGASSTIASMNAGPGMQSPSSYQNSTYGLNMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNISQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLSDKESK
ESSIEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTGSAASGVEG
SVKQEQLSPKKKENNALLRYLLDRDDPSDPLSKELQPKVEGVDNKGSQCSSSAVPSSSQE
KDAKIKTEANEEGSGDLDNLDAILGDLTSSDFYNNSVSTNGSNLGTKQQMFQGTNSLGLR
SPQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
TMGGPNRNVTVNQTASSGDWGLPSSKTSRMEPLSSNSMGRPGADYNASLPRPAVSGSMPT
LPLRSAGIPGARPALPPQQPPQQQMLQMRPGEIPMGVGVSPYGQAAPSNQPGSWPDGMLS
VEQGSHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRAL
GIPELVNQGQALESKQDAFQGQEAAVMMDQKAALYGQTYAAQGPPMQGGFNLQGQSPSFN
SMMNQMSQQGSFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKME
NPTAGGAAVMRPMMQPQVNPQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQ
QQQTQAFSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQPDAAFGRVSSPPN
AMMPSRMGPSQNPMMQHPQTAPMYQSSEIKGWPSGNLARNSSFPQQPFAHQGNPAAYGMV
HMNGSSGPMGQVNVNPMPMSGMPMGPDQILRVPTLCPEKLACPIMIVLSCSSPVLGCPGL
FPK
NT seq 4332 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaggagaaaactccttggatccactggcccctgattcacgaaaacgcaaa
ttgccatgtgatactccaggacagggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaactggctgaacttatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagatc
cgtcaaataaaagagcaaggaaaagccatttccaatgatgatgatgttcagaaagctgat
gtatcttctacggggcagggagtaattgataaagattccttagggccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataagcaagaagacctggttaacacaagtgtctacagt
atcttgcatgaagaagacagaaaggatttccttaaaaacttaccgaaatctacagtcaat
ggagttgcctggacaaatgagacccagagacaaaaaagccatacttttaattgccgtatg
ctgatgaaaacaccacatgatattctggaagacatcaacactaatcctgaaatgcgccag
agatatgaaacaatgcagtgctttgccctgtctcagcctcgagctatgatggaggaaggg
gaagatttgcaatcctgtatgatctgtgtagcacgtcgcattactacaggcgaaagagcg
tttccctcaaaccccgagagctttattactagacatgatctttcaggaaaagttgtcaat
atagatacaaattcactgagatcttccatgaggcctggttttgaagatattatccgaagg
tgtatccagagattttttagtcttaatgatggtcagtcgtggtcccagaaacgtcactat
caagaagcttatatccatggccacgcagaaaccccggtgtatagattctcattggccgac
ggaaccatagtgactgcacagaccaaaagcaaactcttccgaaaccctgtcacaaacgat
cggcatggctttgtctcgacccactttcttcagagggaacagaatgggtatagaccaaac
gcgaatcctgtcggacaaggcattagacctccagcagctggatgcaacagttcggtaggc
ggcatgagcatgtcgccaaaccaaggcttacagatgctaagcggcaggccctatggcttg
gccgaccccagctccacagggcagatgagtgggcctaggtatggggcttccagcaccata
gcttcaatgaacgctgggccaggcatgcagtccccatcttcctatcagaatagcacctat
ggtctcaacatgagtagccccccacacgggagccctggccttggctccaaccagcagaac
atcatgatttctcctcgtaatcgtgggagtccaaagatggcctcacaccagttttctcct
gttgcaggtgtgcactcgcccatgggatcttctggaaatactgggagccacagcttttct
agtagctctctgagtgctcttcaagccatcagtgagggtgtggggacttctcttttatca
actctgtcttcaccaggccccaaactggataactctcccaatatgaatataagccagcca
agtaaagtgaacagtcaggattccaagagtcccctgggcttgtattgtgatcagaatcca
gtggagagttcaatgtgtcagtcaaatagcagggatcacctcagtgacaaagaaagtaag
gagagcagtatcgaagggtcagagaatcagaggggtcctctggaaagcaaaggtcataaa
aaattactgcagttacttacctgttcttctgatgatcggggtcattcctctttgaccaac
tcccccctggactcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcttcttcgacctctggaggagtgtcctccacatccaatatgcacgggtcactgctgcag
gagaaacaccggatcctgcacaagttgctgcagaatgggaattcacccgcagaagtagcc
aagattaccgcagaagccacggggaaagacaccggtagtgcagcgtctggtgtggaagga
agtgtcaagcaggagcaactgagtcctaagaagaaggagaataatgcacttcttagatac
ctgctggacagggatgatcccagtgatccgctctctaaagaactgcagcccaaagtggaa
ggagtggacaataaagggagtcagtgcagcagctccgccgttcctagctcgagtcaagag
aaagacgctaaaattaagacagaagcaaatgaagagggatctggagatttggataatcta
gatgctattcttggtgatctgactagttctgacttctacaataattccgtatccacaaat
ggtagtaatcttggaaccaagcagcagatgtttcagggaactaattctctgggtttgagg
agcccacagtctgtgcagtccattcgtcctccgtataaccgagcggtgtctctagatagc
cctgtttctgttggctcgagtcctccagtaaagaatatcagtgctttccccatgttacca
aagcagcccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctca
actatgggtggaccaaacagaaatgtgactgtgaatcagactgcttcctcgggagactgg
ggcttgccaagctcaaagacgagcagaatggagcctttgagttcaaactccatgggaaga
ccaggagcggattacaacgcttctttgcccagacctgcagtgagcggctcgatgcccacg
ttgccccttcggtccgctggcatcccaggtgcgaggccggcgttgccgccacagcagccg
ccacagcagcagatgcttcaaatgcggcctggtgaaattcccatgggagtgggggtcagt
ccgtatggccaggcagcaccgtccaaccagccgggttcctggccagatggcatgttgtcc
gtggaacaaggctctcatgggactcaaaataggccacttcttaggaattccctggatgat
cttcttgggccaccttctaacctggaagggcagagtgatgaacgagcgttgttggaccag
ctacacactctcttgagcaacacagatgccacaggcttggaagaaattgacagagctctg
ggcatccctgaacttgtgaatcaaggacaagctttggagtccaaacaggatgccttccaa
ggccaagaagcggcagtaatgatggatcagaaagcggcattatatgggcagacgtatgca
gcacaggggcctccaatgcaaggaggctttaatcttcagggacaatcaccatcttttaac
tccatgatgaatcagatgagccaacaaggcagttttcctctgcaaggaatgcacccgcgg
gccaatatcatgagacctcggacaaacacccccaagcaactccgaatgcagcttcagcag
aggctgcagggccagcagtttttgaatcagagccgtcaggcattggaaatgaaaatggaa
aaccccactgctgggggtgctgcggtgatgaggcccatgatgcagccccaggtaaatccc
cagcagggttttcttaatgcccagatggttgcccagcgcagcagagagctgctcagtcat
cacttccgacagcagagggtggccatgatgatgcagcagcagcagcagcagcagcagcag
cagcagcaaacccaggccttcagcccaccccccaacgtgaccgcttcccccagcatggat
ggggtcttggcagggcccgtgatgccacaagcccctccccagcagtttccatacccgcca
aattatgggatgggacaacagccagatgcggcttttgggcgagtgtctagtcctcccaat
gcaatgatgccctcaagaatggggccctcccagaatcccatgatgcagcacccgcagacc
gcgcccatgtatcagtcctcggaaataaaaggctggccatcaggaaacctggccaggaac
agctcctttccccagcagccgtttgcccaccaggggaaccccgcagcatacggtatggtg
cacatgaatggcagcagtggtcccatgggacaggtgaacgtgaaccccatgcccatgtct
ggcatgcccatgggtcctgatcagatactccgtgttcccaccctctgtcctgagaagttg
gcttgtcctataatgattgtgttgagttgctccagtcctgttcttggttgtcctggactt
tttcctaaatag

DBGET integrated database retrieval system