KEGG   Felis catus (domestic cat): 101083355Help
Entry
101083355         CDS       T02385                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     101083355
Peptidases [BR:fca01002]
 Aspartic Peptidases
  Family A1: pepsin family
   101083355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 381 aa AA seqDB search
MKCLVVLLAVLALSQGSEITRVPLHKGKSLRKALKEHGLLEDFLKEHPYGIRKKYSNLDK
VSNEPLANFLDCQYFGKIYIGTPPQEFTVVFDTGSSDLWVPSVDCKSYACKTHHRFDPSK
SSTFQNLNEPLSIQYGTGSMQGFLGLDTVTVSSIVDPQQTVGLSTQEPGNVFTYSEFDGI
LGLAYPSLASEYSVPVFDNMMQKHLVAKDLFSVYLDRNGPGSMLTLGAIDPSYYTGSLHW
VPVTVQEYWQFTVDRVTVNGVVVACDGGCQAILDTGTSMLVGPSSDILNIQTAIGATQDE
YGQFDINCGQLNSMPMVVFEINGRKYPLPPSAYTSQDLGFCASGFQGEGDDPLWILGDVF
IREYYSVFDRINNRVGLAKAI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtctcgtggtgctacttgcagtcctggctctctcccagggcagtgagatcacc
agggttcctctgcacaagggcaaatcgctgaggaaggccttgaaagagcacgggctgctg
gaagactttctgaaggaacacccatatggcatcagaaagaagtactccaacttagacaag
gtgtccaacgagcccttggccaacttcttggactgtcagtactttgggaagatctacatc
gggaccccgccccaggaattcaccgtggtgtttgacactggctcctcggacctctgggtg
ccctctgtcgactgcaagagttacgcctgcaaaacccatcatcgctttgacccatccaag
tcctccaccttccagaacctgaacgagcccctgtccatccagtacggcaccggcagcatg
cagggctttctgggtctcgataccgtcactgtctcctccatcgtggacccccagcagact
gtgggcctgagcacccaggaacctggcaacgtctttacctactctgagttcgatgggatc
ctggggctggcttacccctctctggcctccgagtactcagtgcccgtgtttgacaatatg
atgcagaagcacctggtggccaaagacctgttctctgtttacttggacaggaatggcccg
gggagcatgctcacgctgggagccattgacccctcctactacacaggctccctgcactgg
gtgcccgtgaccgtgcaggagtactggcagttcaccgtggacagggttacggtcaatggc
gtggtggtggcctgcgatggtggctgccaggccatcctggacacaggcacctccatgctg
gttgggcctagcagcgacatcctcaacatccagacggccattggagccacccaggacgag
tatggccagtttgacatcaactgcgggcaactgaacagcatgcctatggtggtctttgag
atcaacggcaggaagtacccactgcccccctctgcctacaccagccaggatctgggcttc
tgcgccagcggtttccagggtgagggtgacgacccgctgtggatcctgggagatgtcttc
atccgggagtattacagtgtctttgacaggatcaacaaccgcgtggggctggccaaggcc
atctga

  All links  
No link information was found.   
DBGET integrated database retrieval system