KEGG   Felis catus (domestic cat): 101083437Help
Entry
101083437         CDS       T02385                                 

Gene name
CHKB
Definition
(RefSeq) LOW QUALITY PROTEIN: choline/ethanolamine kinase
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Choline metabolism in cancer
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101083437 (CHKB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    101083437 (CHKB)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101083437 (CHKB)
    2.7.1.82  ethanolamine kinase
     101083437 (CHKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
B4
AA seq 433 aa AA seqDB search
MTGEEQASRKQTRAQPEGAESARRGLSATGLWAWPRRAMAAEGTAVVGGGAVGGSLAKDG
LLQSQCLDAASNRRRSSSLSRDAERRAYQCCREYLGGAWRRVRPEQLRVDPVSGGLSNLL
FRCSLPDHLPSVGKEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEG
RLEQYIPSRPLKTCELREPVLSAEIATKMARFHGMEMPFTKEPHWLFGTMERYLKQIQDL
PHTGLPQMNLLEMYSLKDEMGNLRKLLDSTPSPVVFCHNDIQEGNILLLSEPENTDRLML
VDFEYSSYNYRGFDIGNHFCEWVYDYTHDEWPFYKAQPADYPTRGQQLHFIRHYLAEVKK
GETISQEEQRKLEEDLLVEANRYALASHFFWGLWSILQASMSTIEFGYLEYAQSRFQFYF
QQKGQLSSFQPSS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagaagagcaggctagccggaagcagacccgagcgcagccggaaggagccgag
tctgcccgaagggggctgagcgcgactggactttgggcttggcccaggcgcgccatggct
gccgaggggacagctgtggtcggaggcggggctgttggcggcagcctggccaaggacggc
ttgctgcagtctcagtgcctggacgcggcctcgaaccggcggcgcagctcgtcgctatcg
cgtgacgccgagcgccgagcctaccagtgctgccgggagtacttgggcggggcctggcgc
cgagtgcggcccgaacagctgagggttgaccctgtgagcggaggcctcagtaacctgctt
ttccgctgctcgctgccggaccacctgcccagcgtcggcaaggagccccgcgaggtgctg
ctgcgactgtacggggccatcctgcagggcgtggattccttggtccttgaaagtgtgatg
ttcgccatcctggcggagcggtcgctggggccccagctctatggagtctttccagagggc
cggctggaacagtacatcccaagccggccactgaaaacgtgtgagcttcgagagccggtg
ttgtcagcagaaatcgccacgaagatggcccggttccatggcatggagatgccgttcact
aaggagccccactggctgtttgggaccatggaacggtacctaaagcagatccaggacctg
ccccacactggcctcccacagatgaacctgctggagatgtacagcctgaaggatgagatg
ggtaacctcaggaaattgctagactctaccccatcaccagtggtcttctgtcacaatgac
atccaggaagggaacatcttgttgctctcagagccagaaaacaccgacagactgatgctg
gtcgactttgagtacagtagttacaactacaggggctttgacattgggaaccatttttgt
gagtgggtttatgattatactcacgacgagtggcctttctacaaagcacagcctgcagac
taccccacccgggggcagcagctccattttattcgccattacctagcagaggtcaagaaa
ggtgagaccatctcccaagaggagcagaggaaactggaagaagatttgctggtagaggct
aatcggtatgctctggcatcccatttcttttggggtctctggtctatcctccaggcatct
atgtccaccatagaatttggttacctggagtacgcccagtctcggttccagttctacttc
cagcagaagggacagctgagcagcttccaaccctcatcctga

DBGET integrated database retrieval system