KEGG   Felis catus (domestic cat): 101083437Help
Entry
101083437         CDS       T02385                                 

Gene name
CHKB
Definition
choline kinase beta
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fca00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 396 aa AA seqDB search
MAAEGTAVVGGGAVGGSLAKDGLLQSQCLDAASNRRRSSSLSRDTERRAYQWRRGVGVRD
RGGRPPAERTPVWVCSGGLSNLLFRCSLPDHLPSVGKEPREVLLRLYGAILQGVDSLVLE
SVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTCELREPVLSAEIATKMARFHGMEM
PFTKEPHWLFGTMERYLKQIQDLPHTGLPQMNLLEMYSLKDEMGNLRKLLDSTPSPVVFC
HNDIQEGNILLLSEPENTDRLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHDEWPFYKAQ
PADYPTRGQQLHFIRHYLAEVKKGETISQEEQRKLEEDLLVEANRYALASHFFWGLWSIL
QASMSTIEFGYLEYAQSRFQFYFQQKGQLSSFQPSS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaggggacagctgtggtcggaggcggggctgttggcggcagcctggccaag
gacggcttgctgcagtctcagtgcctggacgcggcctcgaaccggcggcgcagctcgtcg
ctatcgcgtgacaccgagcgccgagcctaccagtggaggaggggggtgggggtccgggac
cggggcggccgaccgccggctgagcgcaccccggtgtgggtctgcagcggaggcctcagt
aacctgcttttccgctgctcgctgccggaccacctgcccagcgtcggcaaggagccccgc
gaggtgctgctgcgactgtacggggccatcctgcagggcgtggattccttggtccttgaa
agtgtgatgttcgccatcctggcggagcggtcgctggggccccagctctatggagtcttt
ccagagggccggctggaacagtacatcccaagccggccactgaaaacgtgtgagcttcga
gagccggtgttgtcagcagaaatcgccacgaagatggcccggttccatggcatggagatg
ccgttcactaaggagccccactggctgtttgggaccatggaacggtacctaaagcagatc
caggacctgccccacactggcctcccacagatgaacctgctggagatgtacagcctgaag
gatgagatgggtaacctcaggaaattgctagactctaccccatcaccagtggtcttctgt
cacaatgacatccaggaagggaacatcttgttgctctcagagccagaaaacaccgacaga
ctgatgctggtcgactttgagtacagtagttacaactacaggggctttgacattgggaac
catttttgtgagtgggtttatgattatactcacgacgagtggcctttctacaaagcacag
cctgcagactaccccacccgggggcagcagctccattttattcgccattacctagcagag
gtcaagaaaggtgagaccatctcccaagaggagcagaggaaactggaagaagatttgctg
gtagaggctaatcggtatgctctggcatcccatttcttttggggtctctggtctatcctc
caggcatctatgtccaccatagaatttggttacctggagtacgcccagtctcggttccag
ttctacttccagcagaagggacagctgagcagcttccaaccctcatcctga

DBGET integrated database retrieval system