KEGG   Felis catus (domestic cat): 101083692Help
Entry
101083692         CDS       T02385                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fca  Felis catus (domestic cat)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    101083692 (AGMAT)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     101083692 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 282 aa AA seqDB search
MKKLSNANWDGSQDDDSSSSRFGPRRIREESVMLRTTNPSTGALPFQSLSVADLGDVNVN
LYNLQDSCRLIREAYQKIVAAGCIPLTLGGDHTITYPILQAIAKKHGPVGLLHVDAHTDT
ADKALGEKVYHGTPFRRCVDEGLLDRKRVVQIGIRGSAMTLDPYRYSWSQGFRLVLAEDC
WMKSLVPLMGEVRQQMGGKPMYISFDIDGLDPAYAPGTGTPEIAGLTPSQALEIIRGCQG
LNVVGCDLVEVSPPYDPSGNTALLAANLLFEMLCVLPKVTVV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttatctaatgccaattgggatggctcacaggatgatgattcttcctcctcc
agatttggaccccggcggatcagggaagaatccgtgatgcttcggacaaccaaccctagc
acgggggccctccccttccagtccctctcggttgcagatctaggtgatgtgaatgtcaat
ctttacaaccttcaggacagctgccgtctaattcgagaggcctatcagaaaatcgtagca
gctggctgtattcctctgaccttgggtggagatcacacaatcacatatcctatattgcaa
gcgatagccaaaaagcatggccccgtggggctgctgcacgtggatgcccacacggacacg
gctgacaaggccctaggagagaaggtctatcacgggacgcccttccgccggtgtgtggac
gagggactcctggaccgtaagcgtgtggtgcagatcggcatccggggctctgccatgacc
ctggatccctacagatacagctggagccagggcttccggctggtcctggctgaagactgc
tggatgaagtccctggttcctctgatgggggaagtgaggcagcagatgggaggcaaaccc
atgtacatcagctttgacattgacggcttggatcccgcctatgccccggggacagggacg
cccgaaattgctggtctcacccctagtcaggcgctggaaatcatccggggttgtcaaggc
ctgaacgtggtgggctgtgatcttgtggaagtgtcaccgccttatgatccttctgggaac
acggccctcctggcggctaacctgctgtttgagatgctgtgtgtgctccccaaggtgaca
gtcgtctga

DBGET integrated database retrieval system