KEGG   Felis catus (domestic cat): 101083740Help
Entry
101083740         CDS       T02385                                 

Gene name
RAD54B
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
fca  Felis catus (domestic cat)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fca03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
F2
AA seq 911 aa AA seqDB search
MRRSAAPSQLQGNSFKKVKFIPPGRSNPSPDEEITKMSPDVKLLQVSANKNTFLQLQNNT
QICSLNLPTDGSAREINHGHNYNGKHCLEASVMATLDPPHTVHSAPKEITVPKRQEEEEP
DSLVKYFSVVWCKASKKKHKKWEGDAVLIVKGKSFTLKDLEGKDIGRGLAYKFKELEKIE
EGHRVMIGGKEVEVMGIISPDDFNSGRCFQLGGGSLAISSSSQAAKKCFSNPFKSVCKPS
SKENRPNGFQDCKPRHDPHAQNSLVMSRPDNNHQWMFNKNCSPIVDVVIDPYLVYHLRPH
QKEGILFLYECVMGMRVSGRCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTL
IVTPGSLVNNWRKEFQKWLGSERIKIFPVDQDHKVEEFIKSPFYSVLIISYEMLLRSLDQ
IKNVKFDLLICDEGHRLKNSAIKTTTALISLSCEKRIILTGTPVQNDLQEFFALIDFVNP
GILGSLSSYRKIYEEPIILSRQPSASEEEKELGEKRAAELTCLTGLFILRRTQEVINKYL
PPKIENVVFCRPGALQIELYRKLLNSQAVRFCLQGLLGDSPHLICIGALKKLCNHPCLLF
NSIKGRECSSTWDENEERSLYEGLVNVFPADYNPLMFTEEESGKLQVLLKLLAVIRELRP
TEKVVLVSNYTQTLNILQEVCRRHGYAFTRLDGQTPVSQRQQIVDGFNSKYSSDFIFLLS
SKAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIY
QRQISKQDLSGAVVDLTKTSEHIQFSVEELKNLFTLHESSHCVTHDLLDCECTGDKDHTG
DSLEKVPISRNCQLGPHHQKSSSLKPLSMSQLKQWKHFSGDHLNLTDPFLESIRENVSFF
FQNITNQSTVI
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctgcagcaccgagtcagttgcaggggaattccttcaaaaaagtaaaattt
ataccaccaggaaggagtaatccaagtccagatgaagagattacaaagatgagtccagat
gtaaaattacttcaggtttctgcaaataagaatacctttctccagttacaaaataatacc
caaatatgcagtttaaatctgcctactgacggaagtgctagagaaattaatcatgggcat
aattacaatggaaaacactgtcttgaagcatctgtaatggcaacattagatccacctcat
acagttcactcagcccctaaagaaattacagtgcctaagagacaagaagaggaagaacct
gatagcctagttaaatatttcagtgttgtttggtgtaaggcttcaaagaaaaaacacaaa
aagtgggaaggtgatgctgttctcattgtaaaaggaaagtcatttacattaaaggatttg
gaaggcaaagacattggaagaggccttgcatataaattcaaagagcttgaaaagattgaa
gagggccacagagtgatgattggtggaaaagaagtagaagtcatgggcataatctctcca
gatgatttcaacagtggcagatgttttcaacttggaggaggaagccttgctatctcaagt
tcttctcaggctgccaagaagtgtttctctaaccccttcaaaagtgtttgtaaaccaagt
tcaaaggaaaatagaccaaacggtttccaagattgtaaaccacgtcatgacccacatgca
caaaattctcttgtaatgtcgcgaccagacaataatcaccagtggatgttcaataagaac
tgttctcctattgtggatgtagtgatagatccttaccttgtatatcatcttcgaccacat
caaaaagaagggatcctattcctatatgaatgtgtaatgggaatgagagtgagtggcaga
tgtggagctattcttgctgatgaaatgggtttagggaaaacattgcaatgtatttcactc
atctggactctacagtgtcagggaccctatggaggcaagccagtaataaagaagacactt
attgtcacacctgggagcttggtgaataattggaggaaagaatttcaaaaatggctagga
agtgaaaggatcaagatatttcctgttgatcaggaccacaaagtagaagaattcatcaaa
tctccattttattctgttcttatcatcagttatgaaatgttacttcgttccttggatcaa
attaagaatgttaaatttgatcttctaatctgtgatgaagggcatcgtttgaagaatagt
gccattaagacaactacagccctcattagcctttcttgtgagaaaagaataattctaact
ggtactccagttcagaatgatcttcaagaattttttgcattaattgattttgtaaatcca
ggaatattaggctctttgtcatcttatagaaaaatatatgaagaacccatcattttatcg
agacaaccttctgcttctgaggaagaaaaggagttaggagagaaaagagcagctgaactt
acttgcctcactggactctttatccttagaagaacccaagaagtcataaataagtatctt
ccacctaaaatagagaatgtagtcttttgccgaccaggagcactacagattgagctttat
cgaaagctgttgaattctcaggctgtcagattctgccttcaagggttgttaggagatagt
cctcatctaatatgtataggagctcttaaaaagctgtgcaatcacccctgccttttgttc
aactctataaagggaagagaatgtagctcaacgtgggatgaaaatgaagaaaggagtcta
tatgaaggcttggtaaatgtgttccctgctgattacaaccctctcatgtttaccgaggaa
gagtcaggaaaactccaagtgctgttgaagctcttagccgttatccgtgaacttcgtccc
actgaaaaggtggtgttggtgtccaactacacacaaaccttgaatattctacaagaagta
tgcaggcgtcatggatatgcttttacaagacttgatggacaaacaccagtctctcaaaga
cagcaaattgttgatggctttaatagtaaatactcttctgattttatttttttgttaagt
tcaaaagctggtggtgtgggacttaaccttattggaggatctcacttaattctgtatgat
attgattggaatccagccactgatatccaggcaatgtctagagtatggagagatggtcag
aaacatcctgtacatatttacagactcctaaccacaggtacaatagaagaaaagatttat
cagagacaaatcagtaagcaagatctttcaggggcagttgtagacctaactaagacctct
gaacatatccagttctcagtagaggagcttaaaaatttgtttacattacatgaaagttca
cattgtgttacccatgacctgcttgactgtgaatgtacaggagacaaagatcatacaggc
gattcattggaaaaagtccctatctctagaaattgtcagcttggtccacatcaccagaag
tctagctctctgaaacctctctccatgtcacagctgaagcaatggaaacatttttctgga
gatcatttaaatcttacagatccttttcttgaaagcataagagaaaatgtctcattcttt
tttcagaatataaccaaccaaagtactgttatataa

DBGET integrated database retrieval system