KEGG   Felis catus (domestic cat): 101083851Help
Entry
101083851         CDS       T02385                                 

Gene name
CLK3
Definition
CDC-like kinase 3
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 490 aa AA seqDB search
MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRR
YRERRDSDTYRCEERSPSFGEDCYGSSRSHHRRRSREREPYRTRKHAHHCHKRRTRSCSS
ASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGK
SQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLG
KNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLY
NEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSI
GCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSD
GRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEER
SFHTSRNPSR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcatcactgtaagcgataccgctcccctgagccagacccgtacctgagctaccgatgg
aagaggaggaggtcttacagtcgggagcacgaagggaggctgcggtatccgtctcgaagg
gagcctccgccccggagatctcggtccagaagccacgaccgcctgccctaccagaggaga
taccgggagcgccgcgacagtgacacataccggtgtgaagagcggagcccatcctttgga
gaggactgctacggatcttcccgttcccatcatcgtcggcggtcgcgggagagggagccg
taccggacccgcaagcacgcccaccactgccacaaacgccgcaccaggtcttgtagcagc
gcctcctcgagaagccaacagagcagtaagcgcagcagccggagtgtggaagatgacaag
gagggccacctggtgtgccggatcggcgattggctccaagagcgatatgagatcgtgggg
aacctgggtgaaggcacctttggcaaggtggtggagtgcttggaccacgccagagggaag
tctcaggttgccctgaagatcatccgcaacgtgggcaagtatcgggaggccgcccgacta
gaaatcaatgttctcaaaaaaatcaaggagaaggacaaagagaacaaattcctgtgtgtc
ttgatgtctgactggttcaacttccacggtcacatgtgcatcgcctttgagctcctgggc
aagaacacctttgagttcctgaaggagaataacttccagccttaccccctaccacacgtc
cggcacatggcctaccagctctgccacgcccttagatttctacatgaaaaccaactgacc
cacacagacttgaagccagagaacatcttgtttgtgaattctgagtttgaaaccctctac
aatgagcacaagagctgtgaggagaagtcagtgaagaacaccagcatccgagtagctgac
ttcggcagtgccacctttgaccatgagcatcacacgaccatcgtggccacccgtcactat
cgcccacctgaggtgatccttgagctgggctgggcccaaccctgtgacgtctggagcatt
ggctgcatcctctttgagtactaccggggcttcaccctcttccagacccacgagaaccga
gaacatttagtgatgatggagaagatcctggggcccatcccatcgcacatgatccaccgt
accaggaagcagaaatatttctacaaggggggcctggtttgggatgagaacagctctgat
ggccggtatgtgaaggagaactgcaaacctctgaagagttacatgctccaggactccttg
gagcacgtgcagctgtttgacctgatgaggaggatgttagaattcgaccctgcccagcgc
atcacactggcggaggccctgctgcaccccttctttgccggcctgacccccgaggagcgg
tccttccacaccagccgcaacccaagcagatga

DBGET integrated database retrieval system