KEGG   Felis catus (domestic cat): 101083876Help
Entry
101083876         CDS       T02385                                 

Gene name
EHHADH
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
fca  Felis catus (domestic cat)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101083876 (EHHADH)
   01212 Fatty acid metabolism
    101083876 (EHHADH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101083876 (EHHADH)
   00650 Butanoate metabolism
    101083876 (EHHADH)
  Lipid metabolism
   00071 Fatty acid degradation
    101083876 (EHHADH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101083876 (EHHADH)
   00310 Lysine degradation
    101083876 (EHHADH)
   00380 Tryptophan metabolism
    101083876 (EHHADH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101083876 (EHHADH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101083876 (EHHADH)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101083876 (EHHADH)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     101083876 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101083876 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     101083876 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C2
AA seq 723 aa AA seqDB search
MAEYTRLQNWLALIRLRNPPVNAISTSVLHGIKEGLQKAVTDHTVKAIVICGADGKFSAG
ADIHGFTAPRKPTIVLGHVVDEIQRNEKPVVAAIQGMALGGGLELALGCHYRIAHAEAQI
GFPEVRLGLLPGARGTQLLPRLIGVPAALDLITSGRHILADEALKLGILDEMVNSDPVEE
AIKLAQRISGQSLESRRLCNKPIQSLPNMDEIFSEALLKMRKQHPGCLSQETCVRAVQAA
VQYPYEVGIKKEEELFMYLQKSGQAQALQYAFFAERKANKWSAPSGASCKTASAQPISSV
GVVGLGTMGRGIVISFAKAKIPVIAVELDKKQLETADGIITSVLEKEASKMQHSSHHWSG
PKPRLTTSMKELGGVDLVIEAVFEEINLKKQVFAELSAVCKPETFLCTNTSTLDIDEIAS
STDRPHLVIGTHFFSPAHIMRLLEIIPSQYSSLTTIATVMNLSKKIKKIGVVVGNCKGFV
GNRMLKHYYNQSYFLLEEGSKPEEIDQVLEEFGFKIGPFRVSDLSGLDVGWKCRQGEGLT
GPTLPPGTPARKRGNERYCPIPDMLYELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSEFL
SQYRETYHIEPRIISRDEILERCLYSLINEAFRILGEGIAATPEHIDVVYLYGYGWPRHV
GGPMFYASTVGLPTVLEKLQKYYRQNLDIPQLEPCDYLKKLASLGNPPLKEWQSLAGPPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtacacgcgcctgcagaactggctggcgctgatccgccttcgaaacccgccg
gtcaacgccatcagtacatctgtactccatggaataaaagagggactgcagaaagctgta
acagaccatacagtaaaagccattgtgatttgtggagcagatggcaaattctctgcaggt
gctgatatccacggcttcactgctcctagaaagcccaccatcgtattgggacacgtagta
gatgaaatacagagaaatgagaagcccgtggtggcagctattcaaggcatggctttagga
gggggactagagctggccctgggctgtcactataggattgcccatgcagaggctcaaatt
ggcttcccagaagtcagactaggactccttcctggtgcaagaggaacccagcttctcccc
agactcattggagttcctgctgcactcgatttaattacctcaggaagacacattttggca
gacgaagcactcaagctgggcattctagatgaaatggtgaactcagacccggttgaagaa
gcaatcaaattagcccagagaatttctggtcaatctctggaatcccgtagactctgcaac
aagccaattcagagcttacccaacatggacgaaattttcagcgaagcccttttgaagatg
cggaagcagcatcctgggtgcctttctcaggagacttgtgtccgtgcagtccaggctgct
gtacaatatccctatgaggtgggcatcaagaaggaagaggagctgtttatgtaccttcag
aaatcagggcaggctcaagccctgcaatatgctttctttgctgagaggaaggcaaataag
tggtcagctccctctggagcatcctgtaaaacggcgtcagcgcagcccatctcctcagtt
ggtgttgtcggcttgggaacaatgggccgaggcatcgtcatttcttttgcaaaggccaag
atccctgtgattgctgtagaattggacaagaagcagctagagactgccgatgggataata
acctccgttttggaaaaggaagcatccaaaatgcagcatagcagccaccattggtcagga
ccaaaacccaggttaactacgtctatgaaagagcttggtggtgtagatttagtcattgaa
gcagtatttgaggaaattaacttgaagaagcaagtctttgctgaattgtcagctgtgtgc
aagccagaaacttttttgtgcaccaatacttcaaccctggacattgatgagattgcttct
tccactgatcgccctcacttggtgattggcactcacttcttctcaccagctcatatcatg
aggttgttagagattattcccagccaatactcttcccttactactattgccacagttatg
aatttatcaaaaaagattaaaaaaattggagtagttgtaggtaactgtaagggatttgtt
ggcaatcgaatgttaaagcattattacaatcagtcatatttcttgttagaagaaggcagt
aagccagaagagatagaccaggtgctagaagagtttggtttcaaaataggaccttttaga
gtgtcagatctttctggattggatgtgggttggaaatgtcgacaaggggaaggcctcact
ggacctacgttgcctccaggaactcctgcccgaaagcggggcaatgagagatattgccca
attcccgatatgctctatgaattaggacgatttggccagaagacaggtaagggttggtac
caatatgataaaccattgggtaggattcacaaacctgatccctggctttctgaatttctg
tcacagtacagagaaacctatcacattgaaccacgcatcattagccgggatgagatcctt
gagcgctgcttatattcactcatcaatgaagcattccgtatcttgggagaagggatagct
gctactccagagcacattgatgttgtctatttatatgggtatggatggccaaggcacgtg
ggtgggcccatgttctatgcctccacagttgggttgccgacagtgctagagaagttgcag
aaatattataggcagaatcttgatattccacaactagagccctgtgactatctgaaaaaa
ttggcttccttaggaaaccctcctctgaaagaatggcaaagcttggcaggaccccctagc
agtaaattgtga

DBGET integrated database retrieval system