KEGG   Felis catus (domestic cat): 101083892Help
Entry
101083892         CDS       T02385                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101083892 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101083892 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    101083892 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101083892 (ARHGEF1)
   05205 Proteoglycans in cancer
    101083892 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E2
AA seq 999 aa AA seqDB search
MPSTLPVEPMEADDIARGLAPGPPRPGLVPVSIIGAEDEDFENELEMNAEEQNSQFQSLE
QVKRRPAHLMAFLQHVALQFEPGPLLCCLHADMLGSLGPKEARKAFLDFCHSFLEKTAVL
RVPVPPTVAFELDRTRPDLLSEDLQRQFVQEVVQSQQATVSQLLEDFRSKRLMGMTPWEH
DLTQLEAWVGRDRASFEARERHLAERLLTHLEEMQHTISTDEEKSAAVVNAISLYMRHLG
VRTKSGDKKSGRNFFRKKMIGNRRSDEPTKTKKGLSIFLDAARWNRGEPQAPDFRHLKVE
ADAEKPGLTERKGGLGVPSRDRNTGAAGQDIAGVSLHPLSGDSPDREPGVDAPPELGDPP
PQGPASLEPVVPPENTEEGAETERKWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGG
RSRSDVDMDPSSATAVLGPARRATPEPGDEGDPGRSGLELEPEEPPGWRELVPPGTLHSL
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPLEELQYIFPSLDELIEV
HSQFLDQLMKRRQDSGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSHQSFALEQLKAKQ
RKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEELAEREKVER
AAECCREILHHVNQAVRDMEDLLRLKDYQKRLDLSHLRQSSDPMLNEFKNLDITRRKLVH
EGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRL
TSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASR
PKPRPSPSSTREPLLSSSDNGNCGGREMPPADGRMERIFSTLLPYCRPGPEGQLAAKALE
KVLSLKQLLFPSEEDSGAGPPREGDGVPGGGPPSPTQTQTQEIQEKLLSLEETIKQLEEV
EEEFCRVRLLLSQLGKTLSPSLAVPEASCPRQPPGLPQD
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcacactccctgtggagcccatggaggcagacgacattgcccgcgggctggcc
ccgggaccaccgcggcctggcctggtgccagtcagcatcatcggggctgaagacgaagat
tttgagaatgagctggagatgaatgcagaggagcaaaacagccagttccagagtctggag
caggtgaagcggcggcctgcccacctcatggccttcttgcagcacgtcgccctgcagttt
gagccgggacccctgctctgctgcctgcacgcggacatgctgggttcactgggccctaag
gaggccagaaaggccttcctcgacttctgccacagcttcctggaaaagaccgcggttttg
cgggtgccagtccctcccactgttgcctttgaacttgaccgcacacggcccgacctcctc
tccgaggacctccagcggcagtttgtgcaggaggtggtgcagagccagcaggccaccgtc
agccagctgctggaggacttccgctccaagaggctcatgggcatgacaccctgggagcac
gacctgacccagctggaggcctgggtggggcgggaccgtgccagctttgaggcccgggag
cggcacctggccgagcggctgctgacccacctggaagagatgcaacacaccatctcgact
gatgaggaaaagagtgccgccgtggtcaacgccatcagcctgtacatgcgccaccttggg
gtgcggaccaagagcggggacaagaagtcagggaggaatttcttccgaaaaaagatgata
gggaatcggcggtcagatgagccaaccaagacgaagaaaggcctgagcatcttcctggat
gctgcccgctggaatcggggagagcctcaggccccagatttccgacacctcaaagtcgag
gctgatgctgagaagccaggccttacagaaaggaagggaggcctgggggtgccctcccgg
gaccggaacactggggctgccgggcaggacatcgctggagtttccctgcaccctctgtct
ggggacagccctgaccgggagccaggtgttgatgccccaccagagctgggggacccgccc
ccgcagggcccggccagcctggagcccgtggtgcccccggagaacacggaggagggtgct
gagacagagagaaagtggaagaggctatcggggcgtctggggcgctcggagagcctgcgg
gtgagtgaccgccgccggccttcccggggcagcctcggggctaagggccggggtgggggc
cgctcccggagtgacgtggacatggaccccagctctgccacggccgtgcttggccctgcc
cgacgagccacccctgagcctggagatgaaggggacccaggtcggtctggactagagctg
gaaccagaagagccccctggctggcgggagctcgtccccccaggcaccctgcacagcctg
cccaagagccaggtgaagcggcaggaggttatcagcgagctgctggtgaccgaggcggcc
catgtgcgcatgctccgggtgctgcacgacctcttctaccagcccatggcagaaggaggc
ttcttccccctggaggagctacagtacatcttccccagcctggacgagctcatcgaggtg
cattcccagttcctcgatcaactgatgaagcggaggcaggatagtggctacctcattgag
gagatcggagatgtactgctggcccggtttgatggtgccgaaggctcctggttccagaaa
atctcctcccgcttctgcagccaccagtcatttgccttagagcagctcaaagccaaacag
cgcaaggagcctcggttctgtgcctttgtgcaggaggccgagagccgcccacggtgccgc
cgcctgcagctgaaggacatgatccccacggagatgcagcgcctgaccaagtaccccctg
ctcctgcagagcatcgggcagaatacagaagagctggccgaacgggagaaagtggagcgg
gcggctgagtgctgccgggaaattctgcaccacgtcaaccaagctgtgcgcgacatggag
gacctgctgcggctcaaggattatcagaagcgcctggatttgtcccacctgcggcagagc
agcgaccccatgctgaacgagttcaagaacctagacatcaccaggaggaagctggtccac
gagggcccgctgacgtggcgggtgacgaaggacaaggctgtagaggtccacgtgctcctg
ctggacgacctgctgctactgctccagcgccaggacgagcggctgctgctcaagtcgcac
agccggacgctgacgcccacccccgacggcaagaccatgctgcggcccgtgctgcggctc
acgtccgccatgacccgcgaggtggccaccgatcacaaagccttctatgtcatttttacc
tgggaccaagaggctcagatctacgagctggtggcccagaccgtgtcggaacggaagaac
tggtgtgccctcatcacggagaccgctggatccttgaaggtccctgcccctgcctctcgc
cccaaaccccggcccagcccaagcagcacccgggaacccctgctcagcagctcggacaat
ggcaactgtggtggccgagagatgcccccagctgacggccgcatggagagaatcttcagc
accctcctgccctactgcagacccggccctgaaggccagctggcagccaaggcccttgag
aaagtgctgtccctgaagcaactcctgtttccctcggaggaagatagtggggcggggcct
ccccgtgaaggggatggggtcccggggggcggccccccgagcccgacacagacccagacc
caggaaattcaggagaagctgctcagcctggaggagaccattaaacagctggaggaggtg
gaagaggaattctgtcgtgtacgactcctcctgtctcagttggggaaaaccctgtccccc
agcctggctgtacctgaggcttcctgccccaggcagcccccaggccttccgcaagactga

DBGET integrated database retrieval system