KEGG   Felis catus (domestic cat): 101083949Help
Entry
101083949         CDS       T02385                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     101083949 (ACR)
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101083949 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 424 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGSVRIVGGQDAALGAWPWMVSL
QVFTSHNNRRYHACGGTLLNSHWLLTAAHCFGSKKKVYDWRLIFGAREIVYGSDKPVKPP
QQERYVEKIIIHEKYVPSLEYNDIALLKITPPVPCGQFIGPGCLPQFRAGPPRVSQACWV
AGWGFLRENAYRTSPTLQEARVNLIDLDLCNSTQWYNGRIRSTNVCAGYPEGKIDTCQGD
SGGPLMCRDNVANTYVVVGVTSWGVGCARAKRPGVYTATWPYLNWIASKIGSNVLHMAQV
PTPPPPTTPAPPVRLPSAHPSARPPWYFQRPVQPLPVHPPASQPRPRPRPKPPSPVPASX
LPPPPPSPSPPPPAPPPITKPPQXASFAKRLQQLIEILKGKTFSSAKGYYEMETTDLPEL
TAAS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtggagatgctgccaactgccatcctgctggtcttggctgtgtctgtggttgccaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcagaacccacaggggagt
gtccgtatcgtcggagggcaggatgcggcactcggggcctggccctggatggtcagcctc
caggtcttcacttcccacaacaaccgaaggtatcatgcgtgcggaggcaccctgctgaac
tcccactggttgctgacggctgctcactgcttcgggtccaaaaaaaaagtatatgactgg
agactgatttttggagcaagggaaattgtgtatgggagcgataaaccagtgaagccgcct
caacaggagagatatgtcgagaaaatcatcattcatgagaaatacgtccccagtttagag
tacaatgacattgctctcttgaagatcacccctccagttccatgtgggcagttcatcgga
cccggctgcctgccccaatttagggcaggcccacccagagtctcccaggcctgctgggtg
gctggctggggattcttaagagagaatgcctacaggacgtcacctacactgcaggaggca
cgcgtgaacctcatcgatctcgacttatgtaactccacccagtggtacaacgggcgcatc
cggtccaccaacgtgtgcgcggggtaccctgaaggcaagattgacacctgccagggggac
agcggcggtcctctcatgtgcagagacaacgtggcaaatacctatgtggtcgtgggagtt
acaagctggggggtaggctgtgcccgagctaagcgccctggagtctacacggccacctgg
ccctatctgaactggattgcctccaagatcggttctaatgtcttgcacatggctcaagtg
cccacccctcctcctcccactactccagcacccccagtcagactcccctctgcccaccct
tctgctcgccctccttggtacttccaacgccctgttcaaccacttcccgtgcatccccct
gcatctcaacctcgaccccgaccccgacccaaaccccccagccccgtccctgcctccnac
ctcccacccccacctccatccccatccccaccccctcccgcacccccacctatcactaaa
cctccccaangtgcttcttttgccaagcggctacagcaactcatagagatcttgaagggg
aagaccttttctagtgcaaaggggtattatgaaatggagaccacagacctccccgaactg
acggctgcttcctga

DBGET integrated database retrieval system