KEGG   Felis catus (domestic cat): 101083967Help
Entry
101083967         CDS       T02385                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fca00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 346 aa AA seqDB search
MSNLGRGGLSNMLFQCSLPDTVATIGDEPRKVLLRLYGAILKMRSCNKEGSEQAQKENEF
QGAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEK
MATFHGMKMPFNKEPKWLFGTMEKYLNQVLRVKFAGEPRVKQLHRLLRHNLPLELENLRS
LLESTPSPVVFCHNDCQEGNILMLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWM
YDYSYEKYPFFRANILKYPTKKQQLHFISNYLAAFQNEFENLSNEEKCIIEEEMLLEVNR
FALASHFFWGLWSIVQAKISSIEFGYMDYAQARFDAYFDQKRKLGV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacctgggcagaggtggcctcagtaacatgctgttccagtgctccttacctgac
accgtggccaccattggtgacgagcctcggaaagtgctcctgcggctgtacggggcgatt
ttaaagatgaggtcctgtaataaagagggatccgaacaagctcagaaagaaaatgaattt
caaggggccgaggccatggttctggagagcgttatgtttgccattctcgcagagaggtcg
ctgggacccaagctctacggcatcttcccccaaggccgcctggaacagtttatcccgagc
cggcgattagacacagaagaattaagtttgccagatatttctgcagaaatagctgagaaa
atggccacatttcatggtatgaaaatgccattcaataaggaaccaaaatggctttttgga
acaatggaaaagtatctgaatcaagtcctgagggtcaagtttgccggggagcccagagtg
aagcagctccacagactcctccgccacaacctgcctttggaactggagaacctgaggtcg
ctgctggaatccaccccttctccagttgtgttttgtcataacgactgtcaggaaggtaac
atcttaatgctggaaggcagagagaattctgaaaagcagaaactgatgctcatcgacttc
gaatacagcagttataattacaggggatttgacattgggaatcatttctgtgagtggatg
tatgactatagctatgaaaagtaccctttcttcagagccaacatcctgaagtaccccacc
aagaaacagcagctccactttatttccaattacttggccgcattccaaaatgaatttgaa
aacctcagtaatgaagaaaagtgcattatagaagaagagatgttgcttgaagtcaatagg
tttgcccttgcgtcccatttcttctggggactttggtccatcgtacaggccaagatttct
tccattgaatttgggtacatggactatgcccaggcaaggttcgatgcctatttcgaccag
aagaggaagcttggggtgtga

DBGET integrated database retrieval system