KEGG   Felis catus (domestic cat): 101084086Help
Entry
101084086         CDS       T02385                                 

Gene name
HDAC6
Definition
histone deacetylase 6
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101084086 (HDAC6)
  Substance dependence
   05034 Alcoholism
    101084086 (HDAC6)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101084086 (HDAC6)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101084086 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 1136 aa AA seqDB search
MTSTGQDSTSTRQRRSRHNPHSPPHDSSVTSKRGVKKGAILSSSPSLAEVKKKGRMKKLS
QAAEQDLIMDLRRLDLNLEAKTLSGTGLVFDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKDELMLVHSLEYIDLMETTQYMNERELRILADTYDSVYLHPNS
YTCACLASGSVLRLVDAVLGKEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHDIQRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTIGFGHG
QGYTINVPWNQVGMRDADYIAAFLHLLLPVALEFQPQLVLVAAGFDALQGDPKGEMATTP
AGFAHLTHLLMGLAEGKLILSLEGGYNLRSLAEGVSASLHTLLGDPCPILESPGAPCPSA
LASLCCALEALEPFWEVLVRSVETPEEDILEEDSAEEKDEEGLWRPPALPILTWPMLQAR
TGLVYDQRMMGHHNLWDNHHPEMPQRVLRIMQRLEELGLAGRCLALPARPATEAELLTCH
SAEYVGRLRATEKMKTRELHREGSNFDSIYICPSTFACAQLATGAVCRLVEAVLAGEVLN
GTAVVRPPGHHAERDAACGFCFFNSVAVAARHAQAISGQALRILIVDWDVHHGNGTQHIF
EEDPSVLYISLHRYDRGTFFPMGEEGASSQIGRAAGTGFTVNVAWNGPRVGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAAWGDPLGGCQVSPEGYAHLTHLLMGLANGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLSRPPLSGALASITETIQVHRRYWRSLRVMKVE
DKEEPSLSKSVTNPGSAKRMTTPEGNILDAGTEKAVSASSVEESTLGEPKSETAMVELSQ
DQSLEAPTQKAMLDQTTSQAATVEATAGQTTSEEAVGGAEMIQTPPALCTDNQTPTASPE
QGATSQISPSELIENLRTLELNCKAQEAPESQIPEEDKLLGEAAGGQDMLIQSFGVHAST
DQAIFYAVTPLPWCPHLVAVCPTPESGLDVTQPCQDCGTLQENWVCLSCYQVYCGRYVSA
HMLQHHEGSGHPLVLSYVDLSTWCYSCEAYVHHQALLEVKNIAHQNKFGEDMPHSH
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgacctccacgggccaggattccacctcaaccaggcagcgaaggagtaggcataacccc
cattcgcccccccacgactccagcgtcacctcgaagcgaggtgttaagaagggtgccata
ctctcctccagccctagtctagcagaggtaaagaagaaaggcagaatgaagaagctcagc
caagcagcagagcaagacctaatcatggacctgcgaaggctggatctgaaccttgaggcc
aagacactgtctggcactggtttggtgttcgatgagcagctaaatgaattccactgcctc
tgggatgacagcttccctgaaggccctgaacggctccatgccatcaaggaacagctgatc
caggagggcctcctggaccgctgtgtgtcctttcaggctcgatttgctgaaaaggacgaa
ctgatgttggttcacagcctagaatacattgatctgatggagacgacccagtacatgaat
gagagagagctccgcatcctagcagacacctatgactcagtttatctacatccgaactcc
tatacctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgctgtcctgggg
aaggagatacggaatggcatggccatcatcaggcctcctggacaccacgcccagcacagt
cttatggatgggtattgcatgttcaaccacgtggccgtggctgcccgctacgctcaacag
aagcatgacattcagagggtccttatcgtggattgggatgttcaccacggtcaaggaacc
cagttcacctttgaccaggaccccagcgtcctctatttctccatccaccgttatgagcag
ggtcggttctggccccaccttaaggcctctaactggtccaccataggttttggtcatggc
cagggatataccatcaatgtgccttggaaccaggtggggatgcgagatgccgactatatt
gctgctttcctgcacctccttctgccggtcgcccttgagttccagccccagctggtcctg
gtggccgctggatttgatgcccttcaaggggaccccaagggtgagatggccaccactcca
gcagggttcgctcacctaacccacttgctcatgggtctggcagaaggcaaactgatcctg
tctctggagggtggctacaaccttcgctccttggctgagggcgtcagtgcctcactccac
acccttctgggagacccttgccccatactggagtcccctggcgccccctgcccaagtgcc
ctggcgtcactgtgctgcgctctggaagccctggagcccttctgggaggtccttgtaaga
tcagttgagaccccggaggaggacatcctggaggaggatagcgcagaggagaaggatgaa
gagggactgtggcggcccccagcgctcccaatcctgacgtggcccatgctacaggctcgc
acagggctggtctatgaccagcggatgatgggtcaccacaacttgtgggacaaccaccac
ccagagatgcctcagcgagtcttacgaatcatgcagcgtttggaggaactgggccttgcg
gggcgctgcctcgcgctgcccgcacgtcccgccacggaagccgaactgctcacctgccac
agtgctgagtacgtgggtcgtctgcgggccacagagaagatgaaaacccgggagctgcac
cgcgagggttccaactttgattccatctacatctgccccagcaccttcgcctgtgcgcag
ctggccactggcgctgtctgccgcctggtggaggctgtgctggcaggagaggttttgaat
ggtaccgctgtggtgcgtcccccaggacaccatgctgagcgggatgccgcttgtggtttc
tgcttttttaattctgtggctgtggctgctcgccatgcccaggccatcagtgggcaggcg
ctgcggatcctgatagtggactgggatgtccatcatggtaatggaactcagcacatattt
gaggaggaccccagcgtactgtacatttccctgcaccggtatgaccgtggcaccttcttt
cccatgggggaggagggtgccagcagccagataggccgggccgcaggcactggcttcact
gtcaacgtggcctggaatggaccccgtgtgggtgatgctgactacctggccgcgtggcat
cgcctggtgcttcctattgcctacgagtttaacccagagctggtgctggtctcagcgggc
tttgacgccgcatggggggacccactggggggctgccaggtgtcgcctgagggctatgcc
cacctcacccacctgctgatgggccttgccaatggccgcattatcctaatcctagagggt
ggctataacctgacatccatctcggaatccatggctgcctgtacccgctccctccttggg
gacccaccaccactgctgaccttgtcgcggcctccactatcaggggccctggcctcaatc
accgagaccatccaagtccatcgcagatactggcgcagcttacgggtcatgaaggtggaa
gacaaggaggagccctccctttctaagtcagtcaccaaccctgggtcagctaagaggatg
accacaccagaagggaacattctggatgcaggcacagagaaggctgtctcagcatcatct
gtggaagagtccactctaggcgaacctaagtcagagactgctatggtggagctcagtcag
gaccagtccttggaggctcccacacagaaagccatgctggaccagaccacctcacaggca
gccacagtggaggccacagcaggccagaccacctcagaggaggctgttgggggagctgag
atgatccaaacccctccagctttatgtactgacaaccagactcccacagcctcacctgag
caaggtgccacatcccaaatatcccccagtgagctgattgagaatctcaggaccttggaa
ctaaactgcaaggctcaggaggcaccagaatctcagatcccagaagaggataagctactg
ggagaggcagctggaggtcaggacatgctgattcagagctttggggtccatgctagcact
gaccaggccatcttttatgccgtgacaccgctgccctggtgtccccatttggtggcagta
tgtcccacacctgaatcaggcctggacgtgacccaaccttgtcaggactgtggaacactc
caggagaactgggtgtgtctgtcttgctatcaggtctactgtggtcgttatgtcagtgcc
catatgctgcaacaccacgaagggtcaggacacccgctggtcctcagctacgtcgatctg
tctacctggtgttacagctgtgaggcctatgtccaccaccaggctctcctagaagtgaag
aacatcgcccaccagaacaagtttggggaggacatgccccactcacactga

DBGET integrated database retrieval system