KEGG   Felis catus (domestic cat): 101084095Help
Entry
101084095         CDS       T02385                                 

Gene name
KMT2C, MLL3
Definition
lysine (K)-specific methyltransferase 2C
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101084095 (KMT2C)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101084095 (KMT2C)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101084095 (KMT2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 4939 aa AA seqDB search
MHTRVCARAQTHTCTCSSPEMEMSSFVLGQPLCAPEERPRSRGKITVEDEDSMDGLETTE
TENIVETAEIKEQSAEEDAEAEVDISKRPVPVLERSVSEDSASSLVSVGVEVKISEQLCA
FCYCGEKSSLGQGDLKQFRVTPGFILPWKSQPFNKKDIDDSSNGTCDKIQNSASRKQRGQ
RKERAPLQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQALFDPTGTCWAHHRC
VEWSLGVRQLEEPSPVSVDKAVVSGSTERCAFCKHLGATIKCCEDKCTQMYHYPCAAGAG
TFQDFRNFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAV
TPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC
RICVECGTRSSSQWHHNCLVCDSCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLE
CDKPTDHELESQFKEEYICMYCKHLAAEMDPLQPGDEVEMAEVTTDCNNEMEVEGPEDHM
VFPEQVVNEDISGQESTPGIVPDGVHIHTEEQLKSNSPESLDTHDLLISESSQDKMNPAL
ENQISLEADSEKMEMSSKVMHICDENQNENKMEVTENVDVLTHQITVRHEDLQLEEPKML
ASAEESRPPKLSIESATGPPEALRSPCEESTSLCSKEHLAVERVPEAMEQKESSESSAVF
MDFEMAPVVESCVKDGLCQEDKSVKLPSETELSFSSAAGVSKANASSSPLSSDLPSQDTL
HSYPSTLSASVGNIMPTTYISVTPKIGMGKPAITKRKFSPGRPRSKQGAWSTHNTVSPPS
WSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKSGIG
AVVLPGVSAADLSSNKDEEENSMHNTVVLFSSSDKFTLHQDMCVVCGSFGQGAEGRLLAC
SQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCL
DPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREE
DLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYMPTSNVPSSDGCESSLVA
QIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRSKPKLKLKIINQNSVAVL
QTPPDIQSEHSRDGEMDDSREGELVDCDGKSESSPEREAVDDETKGAEGTDGVKKRKRKP
YRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPNRDDGWSEHLPDTLVDESVSV
TENTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTSRQNKLSLDNLSEDTAQLSYKT
NMNTNFLDPSLDPLLSSSSTPAKPGTHGTTDDPLADISEVLNTDDDILGIISDDLAKSVD
HSGLDLCTFQVESSPFPFAGIDIGPVADDASSLPQPSVNPSSRPLSEEQLDGILSPELDK
MVTDGAILGKLYKIPELGGKDVEDLFTAVLSPATAQPTPLAQPPPPPAPQLLPIHSQDVF
SRMPLMNGLIGPNPHLPHNSLPPGSGLGTFSTVAQSPYTDTRDKNPAFHPMASDPNSSWT
SSAPTVEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPSLKEEFPDWTTRVK
QIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDPLKRQQQQDSIDPGSRIDSDLF
KDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQFGAQPPVAPSG
SDTPSSGIQSPLTPQPGNGSASPAQAFHKDLFPKQLPGAPSSASSDDVFVKPQAPPPAAA
PARGPVQESLSQPQTCQPPSPQVFSAGSAHSRPPSPVDPYAKMVGTPRPPPGGHGFSRRN
STALVENCAPLPPVPRPAPVSEATANRPSPVRDFCASSTANGDPYAKPPDTPRPTMTDQF
PKPSGLPRSPVVAEQTAKGPLAAGTSDHFSKPSPRADVFQRQRIPDPYARPLLTPAPPDG
GPGPFKAPMQPPPPSQDPYGPVSQAPRRLSVDPYERPAFAPRPGDNFSHSQSGGPYSQPP
LTPHPATNESLAHPSRAFSQPGTMSRPTSQDPYSQPPGTPRPVVDAYPQPSGTSRSNPDP
YSQPPGTPRPATIDPYSQQPPTPRPPTQADLFVPPAANQRHSDPYAHPPGTPRPYSQPPA
APRPRISEGFPRSSMTRPVLMPNQDPFLQAAQNRGAALSGPLIRPPDTCSPSPRPPGPSL
SETFSRVSPSATRDAYDQPPMTPRTQSDSFGTSQVAHDVGQSRPGSEGSFSAPSNSPMSS
QSQQFSSVSHLPGPVPTSGVTETQSTVNMSQADTEKLRQRQKLREIILQQQQQKKMAGRQ
EKGSQDAVAGPLPAPLQHWQPDSISQAFARAPPPYPGSIRSPVVPPLGPRYAVFPKDPRG
PYPPDVTGMGMRPHGFRFGFPGGSHGTLSSQERFLAPPQQIQGSGAPPQLRRSMSVDMPR
PLNNSQMNNPVGLPQHFPPQSLPVQQHNILGQAFIELRHRAPDGRPRLPFTAPPGSVLEA
PSHPRHGNFIPRPDFPGPRHAEPLRRPSQGLPTQLPLHPNLEQVPPSQQDQSHPAHSSSM
VMRSLSHPLGGEFPEASLSTSTPAETASDNLQITTQSSDGLEEKLDTDDPSVKELDVKDL
EGVEVKDLDDEDLENLNLDTEDGKGDELDTLGNLETNDPNLDDLLRSGEFDIIAYTDPEL
DLGDKKSMFNEELDLNVPIDDKIDNQCGSVEPKMKEQEDKTVVPSDKPSPWKKSTGTGEI
KTEVLSPDSKGEGRCESEKSNESKDNVGTPSSQASAHTDVSDGEKAVPQPCDTDLLEKRT
PREATGSTPGVRGSAQLPAEDVMNSCGITASTPVLSSLLANEKSDNSDVRPLGSPPPTLP
ASPSGHLSSLPPPLMTPPGHMLDSTMNSNVPVVSRVNHTFPQGVQVNPGFVQGQSPVNHG
FGTGKPANQTVPLTSQSGPQQLMIPPTLAQQSRERPLLLEEQPLLLQDLLDQERQEQQQQ
RQMQAMIRQRAEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNMGMPPMVMNRFPFM
GQSVTGAQTSEGQSLLPQAMAQDGSITHQISRPNPPNFGPGFVNDSQRKQYEEWLQETQQ
LLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKQLE
QIRKQQKEHAELIEDYRIKQQQQQQQCAMAPPPVMPGVPPQPPLVPGATPAAMSQPSFPM
VPQQLQHQQHAVISGHSSPARMPGLPAWQPASAPAHLPLNPARIQPPVAQLPIRTCTPAP
GTVSSANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQ
GVGVPPHGPMRSQLPFYSSDLPCDFTQPPRPLQQSPQHQQQMGQSVQQGSLNSPPTPTFM
QTSERRQIGPPSFVPDSPSVPGGSPGFHSVKQVHGGLSGASFQQSPARPPFAPALPAAPA
VASGSLPCGQDPAAAHGQSHPGSTQSLIQLYSDIIPEEKGKKKRTRKKKKDDDVESTKAP
STPHSDITAPPTPSISETTSTPTVNTPSELPQQGEPELVEPVCPSTPDTAAGQLCAELES
RLPQSELAQGAPNRPAFAEAEAEKHSVETPASTEEVALETAEPQQCPGQDGPDLEERAGN
KVEEKAGAGPVSSGQSPPPPAGAPAAKGDSGNELLKHLLKNKKSSSLLSQKPEGSFCSED
ACTKEHKVVERQNPVEGLQTLGAQMQGGFGCGSNPLPKTDGGSETKKPRSKRTQRVGEKA
APRSKKRRKDEEEKRALSSATDTFTHLKQQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGN
RLLGTFGSATLEGVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEEL
AGRAGVLMSHEVTKSLGPKAFQLPFRPQDDLLARAIAQGPKTVDVPASLPTPPHNNQEEL
RIQDHAGGRDTPDSFVPSSSPESVVGMDVSRYPDLSSVKEEPPEPVPSPIIPILPSSTGK
GLESRRNDIKTEPGTLFFTPPFGSSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLH
VRVPNSYEVSNGPDVPSVGLVSSHRVNPGLECRQHIFLRGPPPGSANPPRSASSYRLKPP
SVPFRPASDGLSGYKDSGIAEGAALRPQWCCHCKVVILGGGVRKSFRDLAFVNKDSRESS
HRVEKDIVFCSNNCFVLYASSTQAKNSESKESAPPLPQSPVRETPSKAFHQYSNNISTLD
VHCLPQLQEEASPPASPPITFPPAFEAAKVEAKPDELKVTVKLKPRLRTVHGGFEDCRPI
NKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEE
GDGLTDGPARLLNLDLDVWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKM
GATSGCHRFRCANIYHFTCAIKAQCMFFKDKTMLCPVHKPKGIHEQELSYFAVFRRVYVQ
RDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWS
TRYANRRCRYLCSIEEKEGRPVFVIRIVEQGHEDLVLSDSSPKGVWDKILEPVACVRKQS
EMLQLFPAYLKGEDLFGLTVSAVVRIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGC
ARSEPKMSAHVKRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSN
VYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDSD
HVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFED
DQHKIPCHCGAVNCRKWMN
NT seq 14820 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgcgagtgtgtgcacgggcacaaacacacacatgcacatgcagttcccctgag
atggaaatgagttcatttgtgttagggcagcccctgtgtgcaccggaagaaaggcctcga
agtagaggaaaaattacagtggaagatgaggacagcatggatggactggagacaacagaa
acagaaaatattgtggaaacagcagaaatcaaagaacagtctgcagaagaggatgctgaa
gcggaagtggacatcagcaaacggccagtcccagtcctcgagcgctcggtgtctgaggac
tctgcgagctccctggtctctgttggtgtagaagtcaaaatcagtgaacagctctgcgct
ttttgttactgtggtgaaaaaagttccttaggacaaggagacttaaaacaatttagagta
acgcctgggtttatcttgccgtggaaaagccagccttttaacaagaaggacattgatgac
agcagcaatggaacctgtgacaaaatacaaaactcagcatcacgaaaacaaagaggacag
agaaaagaacgagctcctctacagaatatagtatcttgtgtaagtgtgagcacgcagact
gcttcggatgaccaggctggtaaattatgggatgaactcagtctggttggccttccagac
gccattgatatccaagccttatttgatcctacaggcacctgctgggcccatcaccgttgc
gtggagtggtcgctgggagtgcgccagttggaggagccgtcaccggtgagcgtggacaaa
gctgtcgtctcagggagcacagagcgatgtgcattttgtaagcaccttggagccactatc
aaatgctgtgaagacaagtgcacccagatgtaccattatccttgtgccgctggagctggt
accttccaggacttcaggaacttcttccttctgtgtccagagcacatcgaccaagctcct
gagagatcaaaggaagatgcaaactgtgcagtgtgcgacagcccgggagacctcttagat
cagttcttttgtactacttgtggtcagcactatcatggaatgtgcctggatatagcggtt
actccattaaaacgtgcaggttggcaatgtcctgagtgcaaagtgtgccagaactgcaaa
caatcgggagaagatagcaagatgctagtgtgtgatacgtgtgacaaagggtatcatact
ttttgtcttcaaccagttatgaaatcagtaccaaccaatggctggaaatgcaaaaattgc
agaatatgtgtagagtgtggcacacgatctagttctcagtggcaccacaattgcttggta
tgtgacagttgttaccaacaacaggataacttatgtcctttctgtgggaagtgctaccat
ccagaattgcagaaagacatgcttcactgtaatatgtgcaagagatgggttcacttagaa
tgtgacaaaccaacagatcacgagctggagtctcagttcaaagaagagtatatctgcatg
tattgtaaacacttagctgctgaaatggaccccttacagccaggtgatgaagtggagatg
gccgaagtcactacagattgtaataatgaaatggaagttgaaggacctgaagaccatatg
gtatttccagagcaagtagttaacgaagacatcagtggtcaggagtccacacctggaatt
gttccagatggagttcacatccatacagaagagcagctgaagagtaactcaccagaaagt
ctcgacacacatgatcttctcatttctgaatcctcccaagacaaaatgaatcctgcattg
gaaaatcagatttctctagaagccgatagtgaaaaaatggaaatgtcttctaaagtgatg
catatttgtgatgaaaatcaaaatgaaaacaaaatggaagtgacagaaaacgttgacgtc
cttacacaccagatcactgtgcggcacgaggatctgcagctagaggaacccaaaatgctg
gcatccgcagaagaatcacggcctccgaaattgtccattgaatctgccactggtccccca
gaggccctaaggtccccgtgtgaggaaagtacttctttatgttctaaggaacatttggct
gtcgaaagggtaccagaagcgatggaacagaaagaaagttctgaatcttccgctgtgttt
atggactttgaaatggcccctgtagttgagagttgtgtgaaagatggtttatgccaagaa
gacaaatctgtaaaattaccatcggagacagagttgtcattttcgtcagcggcaggcgta
agcaaggcaaatgcgtcttcctctccactctcttcagacttgccttcccaggacacactg
catagctacccttcaaccctcagtgcttctgttggaaacattatgccaacgacttacatc
tcagtcactccaaaaattggcatgggtaaaccagctattaccaaaagaaaattttctcct
ggtagacctcggtccaaacagggggcttggagtacccataatacagtgagcccaccttcc
tggtccccagacatttcagaaggtcgggaaatttttaaacccaggcagcttcctggcagt
gccatttggagcatcaaagtgggccgtgggtcgggatttccggggaagcggagacctcgt
ggtgcaggactgtcaggacgaggcggcagaggcaggtcaaaattgaaaagtggaatcgga
gcagttgtgttacctggggtgtctgctgcagatctttcgtcgaataaggatgaagaagaa
aactctatgcataatacagtggtgttgttttctagcagtgacaagttcaccttgcatcag
gatatgtgtgtagtttgtggcagctttggccaaggagcagagggaagattacttgcctgc
tctcagtgtggtcagtgttaccatccatactgtgtcagtattaagatcactaaagtggtt
cttagcaaaggttggaggtgcctcgagtgcactgtgtgcgaggcctgtgggaaggccact
gaccccggaagactcctgctgtgtgatgactgtgacataagctaccacacctactgcctc
gaccctcctctgcagaccgtgcccaaaggaggctggaagtgcaaatggtgcgtgtggtgc
agacactgtggggcaacgtctgcaggcctgagatgtgaatggcaaaacaattacacacag
tgtgctccctgtgcaagcttgtcttcctgccccgtctgctatcggaactatcgagaagaa
gatcttattctgcaatgcagacaatgtgacagatggatgcatgcggtttgtcagaactta
aatactgaagaggaagtggaaaatgtagccgacattggttttgattgtagcatgtgcaga
ccctatatgcctacgtcaaatgtgccttcctcagacggctgcgaatcttcacttgtagca
cagattgtcacgaaagtgaaagagctagatccacccaagacatacacccaggatggtgtg
tgtttgaccgaatcagggatgactcagttacagagcctcacagttacagttccacgaaga
aaacggtccaaaccaaagttgaagttgaagattataaaccagaatagtgtggccgtcctt
cagacccctccggacatccaatcagagcattcaagggatggagaaatggatgatagtcga
gaaggagaacttgtggactgtgatgggaaatcagaatcaagtcctgaacgggaagctgtg
gacgatgaaacgaagggggcggaaggaacagacggtgtgaaaaagagaaaaaggaaaccg
tacagaccaggtatcggtggatttatggtacggcaaagaagtcgaaccgggcaaggaaaa
acgaaaagatctgtcattagaaaagattcttcaggctctatttctgagcagttacctaac
agagatgatggctggagtgagcacttaccagatacactagttgatgaatctgtttctgtt
actgaaaacactgaaaaaataaagaagagataccgaaaaaggaaaaataagcttgaagaa
acgttccctgcctatttacaagaagctttctttggaaaagatcttctagatacaagtaga
caaaacaagctaagtttagataatctatcagaagatacggctcaactttcatataaaaca
aacatgaacacaaatttcttggatccttccttagatccactgcttagttcatcatcaact
ccagcaaaacctggaacccacggtacgactgatgaccccttagctgatatttctgaagtc
ttaaacacagatgatgacattcttggaataatttcagatgaccttgcaaaatcagttgat
cattcaggtcttgatttatgcactttccaggttgagagctcaccttttccatttgccggc
atagatattggtcctgtcgctgatgatgcatcgtctttgcctcagccaagtgtcaatccc
agttcacgaccactaagtgaagagcagctagatggaatcctcagtcctgagctagacaaa
atggtcacagatggagcaattcttggaaagttatataaaattccagagcttggagggaag
gatgttgaagacttgttcaccgctgtgcttagtcctgcgaccgcccagccgaccccgcta
gcacagcctcccccaccgcctgcacctcagctgctgcccatacacagccaggatgtgttt
tcgcggatgccactcatgaatggccttattggacccaatcctcacctcccacataattct
ttgcctcctggaagtggattgggaactttctctactgtagcacaatccccttacactgat
accagggataaaaatccagcatttcatccgatggcaagtgatcctaacagctcttggacg
tcatccgctcccacggtggagggagagaacgatacaatgtcaaatgcccagagaagcacg
ctgaaatgggagaaggaggaggctctgggtgaaatggcaacagtagcacctgttctctac
acaaacatcaatttccccagcctgaaggaggaattccctgactggacgacgagagtgaag
cagattgccaagctgtggagaaaagcgagctcgcaggaaagagcgccttacgtgcaaaaa
gccagagataacagggctgctttacgcattaataaagtacagatgtcaaatgatcccctg
aagaggcagcaacagcaagacagcatcgatcctggctctcgcattgattcggaccttttt
aaagatccgttaaagcaaagagaatcggaacatgaacaggaatggaaatttagacagcaa
atgcgccagaagagtaagcagcaagccaaaatcgaagccacgcagaagctcgaacaggtg
aagaacgagcagcagcagcagcagcagttcggcgcgcagccccccgtggccccgtccggc
tcggacacgccgagcagcggcatacagagccccctgaccccccagcctggcaacgggagc
gcgtctcctgcgcaggcgttccataaggacctgtttccgaagcagctccccggcgccccc
tcgtccgcgtcgtcagacgacgtgttcgtgaaaccgcaggctcctcccccggctgcagcc
ccggcccgaggccccgtccaggagagtctgtcacagcctcagacctgtcagcccccttca
ccacaggtgttttcagctgggtccgctcactcccggccaccctccccagtggatccttat
gcaaaaatggttgggactccgagaccacctcctgggggccacgggttttccagaagaaat
tccactgccctggtggaaaactgtgctcctctgcccccagtccccaggcctgctccggtg
agtgaggccacggcaaataggccgtccccagtcagagacttctgtgcttcctccacggca
aatggtgacccctatgcaaagcctccagacacgcccaggcctacgatgaccgaccagttt
cccaagccctcgggcctcccccggtctccggtggttgccgagcagactgcaaaaggccct
ctggcagctggcaccagcgatcacttcagcaaaccgtctcccagggcagatgtgttccag
agacagcggattcctgacccgtacgcacggcccttgttgacacccgcacctcccgacggt
ggccctgggcccttcaaggctccgatgcagccccctccaccttcccaggacccctatggg
ccggtgtcgcaggcaccaaggcgactgtctgtggacccttacgagaggcctgcgttcgca
ccgagacctggagataacttttctcacagccagtcaggtggcccatacagccagcctccc
ctgaccccacatccggcaacaaatgagtctttggcccatccctcaagggctttttcccag
cctggtaccatgtcaaggccgacatctcaggacccgtattcccagcccccagggactcca
cgccctgttgtagatgcttacccccaaccctcgggaacatctcgctccaacccagacccc
tactctcaacctcctggaactccccggcccgccacgattgacccctacagtcagcagccg
ccaaccccaaggccgcctacacaagcagacttgtttgtgccgccggctgcgaaccagagg
cattcggacccctatgcgcatccccctggaacaccacgaccttactctcagccaccagca
gcaccaaggccaaggatttcagagggttttcctcggtcctcgatgacaagaccagtcctc
atgccaaatcaggatcctttcctgcaggcagcacaaaatcgaggagcagctttatccggt
ccattgataaggccgcctgatacatgttccccaagtcctaggccacctggacctagtctt
tcagaaactttcagccgagtttccccgtctgccactcgggatgcgtatgatcagcctcca
atgactccaagaactcagtctgactcttttggaacaagtcaagttgcccatgatgttggt
cagtcaaggcctggatcagaggggagcttcagcgcgccttcaaactctccaatgagttct
caaagccaacaattttccagcgtctcccaccttcctggacctgtaccaacttccggggtc
actgagacgcagagtaccgtaaacatgtcgcaagcagatacagagaaattgagacagcgg
cagaagttacgtgaaatcattctccagcagcaacagcagaagaagatggcaggtcggcag
gagaaggggtcccaggatgcagtagcggggcctcttccagcgcccctgcagcactggcag
ccggacagcatcagccaggcttttgctagggctccgcccccctatcccgggagcatcaga
tctcctgttgtccctcctctgggacccagatacgcagttttcccaaaagatccacgtgga
ccctatcctcctgatgttactggtatggggatgcgacctcacggatttagatttggattt
ccaggaggtagtcatggtaccctgtcaagtcaggaacgcttccttgcacctcctcagcaa
atacaggggtctggagctcctccacagctgagaagatcgatgtccgtagacatgccgagg
cctttaaataactcgcagatgaataacccagttggcctccctcagcattttccaccacag
agtctgccggttcagcagcataacatactgggtcaagcttttattgaactgaggcatagg
gcgcccgatggaaggccgcggctgcccttcactgctcctcccggcagtgttctagaggca
ccttctcatccaagacatggaaacttcattccccggccagacttcccaggccctagacac
gcagagcccttgagacgaccttctcaaggcctgccaacccagctacctttgcatccaaat
ttggaacaagtgccaccatcgcagcaagaccaaagccatcccgcccattcatcttctatg
gtcatgaggtccctgagtcatcccttaggtggtgaattcccagaggcctctttgtcaaca
tctacaccagctgaaacagcatctgataatttacagataaccacccagtcttctgatggt
cttgaagaaaaactcgatactgatgacccatctgtaaaggaactagatgttaaagacctc
gagggagtggaagtcaaagacttggatgatgaagatctcgaaaatttaaatctagacaca
gaggacggcaagggagatgaattggacacgttaggtaatttggaaactaatgaccccaac
ctggatgacctcttaaggtcaggagaatttgatatcattgcgtacacagatccagaactt
gacctaggagataagaaaagcatgtttaatgaggaactagaccttaatgttcccatcgat
gataagatagataatcagtgtgggtctgttgagccaaaaatgaaggagcaggaagacaag
actgtggttccttctgataaaccttctccgtggaaaaaatccactggtaccggtgagata
aaaacagaagtactgtctccggattctaaaggggaaggcagatgtgaaagtgagaaaagc
aatgagagtaaagacaacgtcggcacccccagctcacaggcttcagctcacacagatgtc
agtgacggagaaaaggctgtcccgcagccctgcgacacggatctgctggagaagagaacc
ccccgagaagccactggctccaccccaggtgtccgcggctccgcgcagctgcctgcggaa
gacgtgatgaactcttgcggcataaccgcatcaactcccgttctctcgagtttacttgct
aatgaaaagtctgataactcagacgtcaggcccctggggtccccgccacccacgctgcca
gcctcaccatccggtcacctgtcaagtttgccgcctcctttaatgacaccgcccgggcac
atgttggatagtaccatgaattctaacgtgccagtagtctctagggtaaaccacactttt
cctcagggcgtgcaggtaaatccaggattcgttcagggtcagtcaccagttaatcacggt
tttgggaccggaaaacctgcaaatcaaactgtgcctctcacgagccagtctggaccccag
cagctgatgatccctcccacgttagcccagcagagtagagagaggcccctccttctggag
gaacagcctctgcttctgcaggaccttctggatcaagagaggcaggagcagcagcagcaa
agacagatgcaagctatgatccgccagcgggcagagccgtttttccctaacatcgatttt
gatgcaattacagatcctataatgaaagccaaaatggtggccctaaaaggcataaataaa
gtaatggcacaaaacaatatgggcatgccacccatggttatgaacaggttcccctttatg
ggccagtcggtgaccggggcgcaaaccagcgaaggccagagtctcctcccgcaggcgatg
gcccaggatggcagtataacacatcagatttctaggcctaatcctccaaattttggtcca
ggctttgtcaatgattcacaacgtaaacagtatgaagaatggcttcaggagacccaacag
cttcttcagatgcagcagaaatatctcgaagaacaaattggcgcgcacagaaagtctaag
aaggccctttccgcgaaacaacggactgcaaagaaagcagggcgggaatttccagaagag
gatgcggaacaactcaagcatgttacggaacagcagagcatggttcagaaacagctagaa
cagatccgcaaacagcagaaggagcatgccgagttgatagaagattatcggatcaagcag
cagcagcagcagcagcagtgcgccatggcgccgcctcccgtgatgccaggggtcccgccc
cagccacccctggttccgggtgccaccccagctgccatgagccagcccagcttccccatg
gtgcctcagcagctgcagcaccagcagcacgcggtgatttctggtcactccagccctgcg
agaatgcctggtttgccggcgtggcagcctgccagtgctcctgcccacctccccctcaat
cctgccaggatccagcctcccgttgcccagttaccaataagaacttgcacgccggcgcca
gggacggtgtccagtgcaaatccccagagtggaccgcccccacgggtggagtttgacgac
aacaaccccttcagtgagagtttccaggaacgagagcggaaagaacgtttacgagaacag
caggaaagacagcgaatccagctcatgcaagaggtggacaggcaacgggctctgcagcag
ggggtgggggtgccgccgcatggccccatgcggtcccagcttccgttctacagctccgac
ctgccttgtgactttacccagccgccacggccccttcagcagtctccgcaacaccaacag
cagatggggcagagcgtccaacagggatctcttaattcccctcccaccccaacgttcatg
caaaccagtgagcgaaggcagatagggcctccctcgttcgttccggactcgccgtcagtt
cctggcggaagccccggcttccattctgttaagcaggtacacggaggtctttctggggcc
agcttccagcagtccccagcgaggcctccttttgcgcctgcattacccgcggcacccgca
gtagctagtggcagtctcccgtgtggccaagaccctgccgcagcccacggacagagtcac
ccagggtcgacccagtcgctcattcagttgtattctgacataatcccagaagaaaagggg
aaaaagaaaagaacaagaaagaagaagaaagacgatgatgtggaatccaccaaggcacca
tccactccccactcagatataactgctccccccaccccgagtatctcagaaactacctcc
acacccaccgtgaacacacccagcgagcttcctcagcaaggagaacccgagttggtggaa
cccgtctgcccgtcgactcccgacacggccgccggccagctgtgcgcagagttagaaagc
aggctgccccagagtgagttagctcagggagctccaaaccgacccgccttcgcggaggcg
gaggcggaaaagcactccgtggaaacccctgcctccacggaagaggtggcgctggagacc
gccgagccccagcagtgccccggccaagacgggcctgacctggaggaacgagccggaaat
aaggtcgaggagaaagccggggccggtcctgtctcctcagggcagagccctccccctcct
gccggggcccctgctgccaaaggagattcgggcaacgagcttctgaagcatctgctgaaa
aataaaaagtcatcttcccttttgagtcaaaagcctgaaggcagcttttgttcggaagat
gcgtgtacgaaggagcacaaagtggttgagaggcagaacccagtcgaaggattgcaaact
ctgggggctcagatgcaaggtggttttggatgtggcagcaaccccttgccaaaaacggat
ggaggaagtgagaccaagaaaccgcgaagcaaacggactcagagggtgggggagaaggcc
gcaccgcgctcgaagaaaaggcggaaggacgaagaggagaaacgcgccttgtcctctgcc
accgacacctttacgcacctgaagcagcagctctctctgctccctctaatggaaccaatc
attggagtgaactttgcgcactttcttccttatggcagtggccaatttaatagtgggaac
cgacttctaggaacttttggcagtgctacccttgaaggggtttcggattactattctcag
ttgatctacaagcagaataatttaagtaatcctccaacaccccctgcctctcttcctcct
acaccacctcctatggcttgtcagaagatggcaaatggttttgcgacaactgaagaactt
gctggaagagctggcgtattaatgagccacgaagttaccaaaagtctaggaccgaaagca
tttcagctgcccttcagaccacaagacgacttgttagccagagctatcgctcagggcccg
aagaccgtcgatgtgccagcctcactgccgacaccgcctcataacaatcaggaagaatta
aggatacaggatcacgctggtggtcgggacactcctgacagtttcgttccgtcgtcctct
cctgagagtgtggttgggatggacgtgagcagatacccagatttgtcgtcggtcaaagag
gagcccccggagcctgtgccatcccccatcatcccgatccttcctagcagtactggcaaa
ggtttggaatctagaaggaatgacatcaagactgagcctggcactttatttttcacaccg
ccttttggttcctctccaaacggtcccagatcgggtcttatatctgtggcaattactctg
catcctacagctgctgagaacattagcagcgtcgtggctgcgttttccgaccttctccac
gtccgagttcctaacagctatgaggtcagtaatggtccagatgttccatccgtgggtttg
gtcagtagccacagagtaaacccaggcttggagtgtcgacagcatatatttcttcgtggg
cctccgccaggatctgcaaaccctcccagatcagccagctcttaccggctgaagccgccc
agcgtgccgttccgtccagcgagcgatggtctttctggatataaggattccggtattgca
gaaggcgcggccctcagaccacagtggtgctgtcactgtaaagtggttattcttggaggc
ggtgtgaggaaatctttcagagatctcgccttcgtgaacaaggattcccgagaaagctcc
cacagagtcgagaaggacattgtcttctgtagtaataactgcttcgttctttatgcctca
tccacacaagcaaaaaactcagaaagcaaggaatccgcccctccgttgccacagtcgcct
gtaagagagacgccttccaaagcgtttcaccagtacagtaacaacatctccaccttggac
gtgcactgcctcccgcagctccaggaagaagcttctccccccgcgtcaccccccatcact
ttccctccggcttttgaagcagccaaagtagaggccaagccagacgagcttaaggtgaca
gtcaagttaaagcctcggctaagaactgtccacggtgggtttgaagattgtaggccgatt
aataaaaagtggagagggatgaaatggaagaagtggagcatccacattgtaatccccaag
gggacattcaaacccccttgtgaggatgaaatcgacgagtttttgaagaagctgggcacg
tcccttaagcctgaccctgtgcccaaagactatcggaagtgttgcttttgccacgaagag
ggtgatggattgaccgacggaccggcaagactgctcaaccttgacttggacgtgtgggtc
cacctgaactgtgcgctgtggtccacggaggtctatgagacccaggccggggccttgata
aacgtggagctggcgctgaggaggggcctgcagatgaagtgcgtcttctgccataaaatg
ggcgccaccagcggatgccacagatttcggtgcgccaacatttaccacttcacttgcgcc
attaaagcacaatgcatgttttttaaggataaaacgatgctgtgtcccgtgcacaaacca
aagggaattcacgagcaggagctgagttacttcgcggtcttcagacgggtctacgttcaa
cgcgacgaggtgcgacagatagctagcatcgtgcagcgcggagagcgggaccacaccttc
cgcgtcggaagcctcatcttccacacgatcggccagctgctcccacagcagatgcaggcg
ttccattcccccaaggcgctcttccccgtgggctacgaggccagccgcttgtactggagc
acccgctacgccaacaggcgctgccgctacctgtgctccatcgaggagaaggaggggcgc
ccggtgttcgtcatccgaatcgtggagcaaggccacgaagacctggtcctgagcgactcc
tcccctaaaggtgtttgggataaaattttggagcccgtggcgtgtgtgagaaaacagtct
gaaatgctccagctctttccagcatatttaaagggagaagacctgtttggcctaacggtg
tccgcggtggtgcggatcgcggagtccctgcctggggttgaggcgtgtgaaaactacacc
ttccgctacggccgcaaccctctcatggagcttcctcttgccgttaaccccacaggctgc
gcccgatcggaacctaaaatgagtgcccatgtcaagagacctcacaccctgaacagcacc
agcacctccaagtcctttcagagcacggtcaccggcgagctgaacgcgccctacagcaag
cagtttgtgcactctaagtcctcgcagtaccggaagatgaagaccgagtggaagtccaac
gtgtacctggcccggtcccgcatccaggggctgggcctgtatgctgctagagacatcgag
aagcacaccatggtcatcgagtacatcgggactatcattcgaaacgaagttgccaacaga
aaggagaagctgtacgagtctcagaaccgcggcgtgtacatgttccgcatggatagtgac
cacgtgatcgacgcgacgctcaccggagggcctgccagatacatcaaccattcgtgtgcg
cctaactgcgtggcagaagtggtgacttttgagaggggacacaaaattatcatcagctcc
aaccggaggatccagaagggagaggagctgtgctacgactacaagttcgacttcgaggac
gaccagcacaagattccgtgtcactgcggggccgtgaactgccggaagtggatgaactga

DBGET integrated database retrieval system