KEGG   Felis catus (domestic cat): 101084116Help
Entry
101084116         CDS       T02385                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
fca  Felis catus (domestic cat)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101084116 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101084116 (GALC)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     101084116 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 712 aa AA seqDB search
MNLYVETVLIDEDPEIHRVTGVDSDKAGARTITLVQAWAPFAVERAFLRVAPEMAKDPGS
ISLSKRMLQCGGQCTVCLCWEARQVPQGLFRKATSRLLVNYPEPYRSQILDYLFKPNFGA
SLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNIILMGLPWSF
PGWLGKGFNWPYVNLQLTAYYVMTWIVGAKHYHDLDIDYIGIWNERSFDINYIKVLRRML
NYQGLHRVKIIASDNLWEPISASMLLDTELLNVIDVIGAHYPGTRTVRDARLTKKKLWSS
EDFSTLNNDVGAGCLGRILNQNYINGYMTATIAWNLVASYYEQLPYGRCGLMTAQEPWSG
HYAVEPPIWVTAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIVETMSHKHSR
CIRPFLPYFNVSHQFATFLLKGSFSEIPELQVWYTRLGKPSKRFLFKQLDSLWLLDSGGA
FTLELQEDELFTLTTLTTGGKGSCPPPPESQPFPQVYDDDFDVDYPFFSEAPNFADQTGV
FEYFTNIEDPGEHRFTLRQVLNQRPITWAADAYNTISVIGDYKWSNLTVRCDVYIETPEK
GGVFIAGRVNKGGILIRSARGVFFWIFANGTYKVTGDLAGWITYALGHVDVTAKRWYTLT
LIIKGRFSSGTLNGKSVWKNIPVSFPKNGWAAIGTHSFEFAQFDNFHVEATS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttatgtggagacagttttaatagacgaggatccggagatccaccgagtgaca
ggtgtcgatagtgacaaggctggggctcgcaccatcaccctcgtacaagcctgggctccg
tttgcggtggagagggcattcctgagggtcgctccagaaatggccaaggatccggggagc
atctctctttccaaaaggatgcttcaatgcgggggccagtgcacagtatgtttgtgttgg
gaggcaagacaggtgcctcaaggcctctttaggaaggcaacctcccgacttctagtaaat
tacccggagccctatcgttctcaaatattggattatctctttaagccaaacttcggtgcc
tctttgcatattctaaaagtggagataggtggtgatgggcagactacagatggtactgaa
ccctcccacatgcactatgcattagatgagaattatttccgaggatatgagtggtggtta
atgaaggaagctaagaagcggaaccctaatattatactcatggggttgccatggtcattc
cctggatggctggggaaaggtttcaactggccttatgtaaatcttcagctgactgcctac
tacgtcatgacctggattgtgggcgccaagcattatcatgatttggacattgattatatt
gggatttggaatgagaggtcatttgacatcaattatatcaaggtgttaagaaggatgctg
aactatcaaggtctccatcgagtgaaaatcatagcaagtgacaatctctgggaacccatt
tctgcttctatgttgctcgacactgagctcttgaatgtgattgatgttataggagcgcat
tatcctgggacccgaacggtgagggatgcgaggttgaccaagaagaagctttggtcttct
gaggattttagcactttaaacaatgatgtgggtgcaggctgcttgggtcgcatattgaat
cagaattacatcaatggctacatgactgccacaattgcttggaatttggtggcgagttac
tatgaacagttgccttatggacgatgtgggttgatgactgctcaggagccgtggagcggg
cactatgctgtagaaccccccatctgggtcacagcccataccactcagtttactcagcca
ggttggtattacctgaagacagttggtcacttagagaaaggaggaagctacgtggctctg
actgatggcttaggtaacctcaccatcatcgttgaaactatgagccataaacattctagg
tgtatacggccgtttctgccttatttcaatgtgtcgcaccagtttgctaccttccttcta
aagggctcttttagtgaaataccagagctacaggtgtggtataccagacttggaaaacca
tcgaagagatttctttttaaacaactggattctctatggcttctcgacagcggtggcgct
ttcacgctggagctgcaggaagacgagctcttcaccctcaccactctcaccaccgggggc
aagggcagctgcccgccgcctccagagtcccagcctttcccgcaggtgtatgatgatgat
ttcgatgttgattacccgttttttagtgaagctccgaattttgcagatcagactggtgtc
tttgaatactttacgaatatcgaagaccctggagagcatcgcttcacgctgcgccaagtt
ctcaatcagcggcccattacctgggccgctgatgcatacaacactatcagtgttatagga
gattacaaatggtccaacctgactgtgaggtgtgatgtttacatagagactcctgagaag
ggaggcgtgttcattgcgggaagagtaaataaaggtggtatcttgattagaagcgctaga
ggagttttcttctggatttttgcaaatggaacctacaaagttacaggtgacctagctgga
tggatcacatatgctttaggacatgttgacgttacagcgaaaagatggtatacgctcaca
ttaattattaagggccgtttctcctctggcacgttgaatggcaagtctgtctggaagaat
atccctgtgagtttcccgaagaatggctgggccgcgattggaactcactcttttgaattt
gcacagtttgacaactttcacgtggaagccacaagctaa

DBGET integrated database retrieval system