KEGG   Felis catus (domestic cat): 101084277Help
Entry
101084277         CDS       T02385                                 

Gene name
USP34
Definition
(RefSeq) ubiquitin specific peptidase 34
  KO
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101084277 (USP34)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101084277 (USP34)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101084277 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
A3
AA seq 3547 aa AA seqDB search
MSLTESRVAIDTHAVSDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQVEEPLSIERECNEGSTERQK
SIEKKSNSTRICNLTEEESSKSCDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTH
PTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFL
IAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTV
KEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETS
IAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKH
CSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNALAAKA
QLSKQSSFASLLNTNLPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMD
EQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQ
SAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICLGDSQG
PSERSGTSNGTGKDLVFNTDSMPSVDNRIRMLDACSHSEDREHDISGEMNAAHIAQASQE
SCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHHDGHMVDDMLSADDVSCSSS
QVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHK
HQFNSNAVTDINLDNVCKKGNTLLWDIVQDDDAVNLSEGLINEAEKLLCSLVCWFTDRQI
RMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFD
NLVYYIQAVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLV
EDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNL
ARLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFI
SKCMESLMIASSSLEQESHSSLTVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSH
LKALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQL
QEFGQSSRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGAPRRER
KGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVEDTESLR
CEELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQSNDGLNWKELLKIKSAHKLLY
ALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGLQQLLE
IFNSGILEPKEQESWTVWQLDCLACLLKLICQFAIDPSDLDLAYHDVFAWSGIAESHRKR
TWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVTYTYDNLAPRVLKAQSDH
RSRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIPETAVRHESCNGLYK
LSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIRIDDYEEEPMLKPGCKEYFWLLC
KLVDNIHIKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVIK
HKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENY
RLIHNWVMAQHMQSHAPYKWDYWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEAR
QAVFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDM
TEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMK
NIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMM
KEKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGFKEVSDHSKDTESYEYDLIGVTVHTGT
ADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDK
FMDFSFEKTHSAYMLFYKRMEPEEENGKEFKFDVSSELLEWIWHDNMQFLQDKNIFEHTY
FGFMWQLCSCIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNS
QAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMED
GSDDMDASVEDIGGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQF
LLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIA
LVALLVEQSRSERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNR
LAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNP
SQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQ
MFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFM
TYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCADCPENIRLI
VQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQ
WAFKNLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGR
SCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLS
IFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVL
LSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCL
LPTMVETSKGKDDVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLP
LHLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFMTH
FLLKVQGQVFSEANCANLISTLITNLINQYQNMQSDFTNRVEISKASASLNGDLRALALL
LSVHTPKQLNPALIPTLQELLSKCRTCLQQRNSLQEQEAKERKTKDDEGATPVKRRRVSS
DEEHTVDSCISDMKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEV
PSSFSEDMSSIRSQHAEEQSNEGRFEDCKEFKDLHCSKDSNLAEEESEFPSTSISAVLSD
LADLRSCDGQALPSQDPEAALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVITRISG
KGNQAAS
NT seq 10644 nt NT seq  +upstreamnt  +downstreamnt
atgagccttacagaatcgagggtagcgatcgacacgcatgcagtatcagatatagaaggt
ggtgatggactgcagctcagaaaggaacatactctcaaaatatttgcttatatcaattcc
tggacacagaggcaatgtctatgctgcttcaaggaatataagcatttggagatttttaac
caagtagtgtgtgcacttattaacttagtgattgcccaagttcaagtactccgggaccag
ctttgtaaacattgtactactattaacatagattccacgtggcaagatgagagtaatcaa
gtggaagaaccactgagtatagaaagagagtgtaatgaaggaagtacagaaagacaaaaa
tcaatagaaaaaaaatcaaactctacaagaatttgtaatctgactgaggaggaatcttca
aagagttgtgatccttttagtttatggagtacagatgagaaggaaaaactcttactatgt
gtggcaaaaatttttcaaattcagtttcctttatataccgcgtacaagcataatactcat
cctactatagaggatatatcaacccaagaaagcaacatattaggggcattctgtgatatg
aatgatgtagaagtaccattgcatttgcttcgttatgtatgtttgttttgtgggaaaaat
ggcctttctctcatgaaggattgctttgaatatggaactcctgaaactttgccatttctt
atagcacatgcatttattacagttgtatctaatattagaatatggctacatatccctgct
gtcatgcagcacattatcccctttaggacctatgttattaggtatttatgcaagctctct
gatcaggagttaagacagagtgcggctcgcaacatggctgacttaatgtggagcacagtg
aaagaaccattggatacaacattatgctttgataaagaaagtttagatcttgcatttaag
tactttatgtcaccaactctgactatgaggttggctggactaagtcagataacgaatcaa
cttcataccttcaatgatgtatgcaataatgaatccttggtatcagacacagaaacgtcc
attgcaaaagaacttgcagactggctaataagcaacaatgtggtagagcatatatttgga
ccaaatttacatattgagattatcaaacagtgccaagtgattttgaacttcttggcagca
gaagggagactgagtactcagcatattgattgcatatgggctgcagcacagttgaaacat
tgtagtcggtacatacatgacttatttccttcactcatcaagaatttggatccagtgcca
cttagacatctccttaatctggtctcagctcttgagccaagtgttcatactgaacagacc
ctatacttggcatcgatgttaattaaagcattatggaacaatgcactagcagctaaggct
cagctgtctaaacagagttcttttgcatcattattaaatactaatcttcccattggaaat
aagaaagaggaagaagagctcagaagagcagccccatcaccttggtcacctgctgctagt
cctcaaagcagtgataacagtgatacacatcaaagtggaggcagtgacattgaaatggat
gagcaacttattaatagaacgaaacatgtccaacaacgactttctgacacagaggaatct
atgcagggaagttctgatgaaactgccaacagtggtgaagatggaagcagtggtcctggt
agcagtagtgggcatagcgatggatctagcaatgaggtgaattctagccatgccagccag
tccgctgggagccctggcagtgaggtacagtcagaagacattgcagatattgaagccctt
aaagaagaagatgaagatgatgatcatggtcataatcctcctaaaagcagttgtggtaca
gatcttcggaacagaaagttagaaagccaagcaggcatttgcttaggggattcccaaggc
ccatcagaaagaagtgggacaagcaatggaacaggaaaggacctggtttttaacactgat
tcaatgccttcagtagataatcgaatacgaatgctagatgcctgttcacactctgaagat
cgagaacatgatatttcaggggaaatgaatgctgctcatatagcacaagcatctcaggaa
tcttgtattacacgcactggggactttcttggggagactattgggaatgaattatttaat
tgtcggcagtttattggtccacagcatcaccaccaccaccaccaccatcatcatcaccac
catgatgggcatatggttgatgatatgctaagtgcagatgatgtcagttgcagtagctcc
caggtcagtgcaaaatcagaaaaaaatatggctgattttgatggtgaagaatctgggtgt
gaagaggaactagttcagattaattcacatgcagagctaacatctcatctccaacaacat
cttcccaatttagcatctatttaccatgaacatcttagtcaaggacctgcagttcataaa
catcaattcaacagtaatgctgtgacagacattaatttggataacgtttgcaagaaagga
aacactttgttgtgggatatagttcaagatgatgatgcggttaatctttctgaaggatta
ataaatgaagcagagaagcttctctgttccttagtatgttggtttacggatagacagatt
cgaatgagattcattgaaggttgccttgaaaatttaggaaacaacagatcagtagtaatt
tcacttcgtcttcttccaaagttgtttggtacttttcagcagtttggaagcagttatgat
acacattggattacaatgtgggcagaaaaagaactgaacatgatgaagcttttctttgat
aatttggtatactatattcaagctgtaagagaaggaagacaaaaacatgcgctgtacagc
catagtgccgaagttcaagttcgacttcagttcttgacttgtgtgttttcaactctggga
tcacctgatcatttcaggttaagtttagagcaagtcgacattttatggcattgtttagta
gaagattctgagtgttatgatgatgcacttcattggtttttaaatcaagttcgaagtaaa
gatcaacatgccatggggatggaaacctacaaacatcttttcctggagaagatgccccag
ctaaaacctgaaacaattagcatgactgggttaaacctgtttcagcatctctgtaacttg
gctcgactggcgaccagtgcctatgatggtggttcaaactctgagctttgtggtatggac
caattttggggcattgctctaagagcacagtctggtgatgtcagtcgagcagctatccag
tatattaactcctattatattaatggtaaaacgggtttggagaaggagcaagaatttatt
agtaagtgtatggagagtcttatgatagcttctagcagtcttgaacaggaatcacactca
agtctcactgttatagaaagaggactccttatgctgaagacacatctggaagcatttagg
agaaggtttgcctatcatctcagacagtggcaaattgaaggcactggtattagtagtcat
ttgaaagcactgagtgacaaacagtccctgccgctaagggtcgtatgccagccagccgga
cttcctgacaagatgactattgaaatgtatcctagtgaccaggtagcagatcttagggct
gaagtaactcattggtatgaaaatttacagaaagaacaaataaatcaacaagctcagctt
caggagtttggtcaaagcagtcgaaagggagagtttcctggaggccttatgggacctgtc
aggatgatttcatctggacatgagttaacaacagattatgatgaaaaagcacttcatgag
cttggttttaaggatatgcagatggtatttgtatctttgggtgcaccaagaagagaacgg
aaaggggaaggtgttcagctgcctgcatcttgcctaccaccccctcagaaggacaacatt
cctatgcttttgcttttacaagaacctcatttaactactctttttgatttattagagatg
cttgcatcatttaaaccaccctcaggaaaagtggcagtggaagatactgagagcttaaga
tgtgaagaacttcatcttcatgcagaaaatctctctaggcgtgtatgggagctactgatg
cttcttcctacatgtcctaatatgttgatggcattccagaatatctcagatgaacagagt
aatgatggacttaattggaaagaacttctcaaaattaagagtgctcacaagctattatat
gccctggaaattattgaagcactgggaaaacctaacaggaggataaggagagagtcaacg
ggaagttacagtgatctttatccagattcagatgattcaagtgaggatcaagtggaaaat
agtaaaaattcctggagttgcaagtttgttgctgctggagggcttcaacagttattggaa
atttttaattctggaattctggagcctaaagagcaggaatcctggactgtgtggcagcta
gactgtcttgcttgcttgctgaagttaatatgccagtttgcaatagatccatctgatttg
gatttagcttatcacgatgtctttgcctggtctggtatagcagaaagccataggaaaaga
acttggcctggtaaatcaagaaaggctgctggtgatcatgccaagggtcttcatatacca
agattaacagaggtatttcttgttcttgtccaaggaaccagtttgattcagcgacttatg
tctgttacttatacatatgataatctggctcctagagttttgaaagctcagtctgatcac
aggtctaggcatgaagtttcacattattcaatgtggctcttggtgagttgggcacattgc
tgttcattagtgaaatctagccttgctgatagtgaccatttacaagattggttaaagaaa
ttgactctccttattcctgagactgctgtccgtcatgagtcttgcaatggtctttataag
ttatctctgtcagggctggatggaggagactcaatcaatcggtcctttctgctattggct
gcttcaacattgttgaaatttcttcccgatgctcaagcgctcaaacctatcaggatagat
gattatgaagaagaaccaatgttaaaacctggatgtaaagagtatttttggttgttgtgc
aaattagttgacaatatacatataaaggatgctagtcagaccacactcctcgacttagat
gctttggcacgacatttggctgactgtatccgaagcagggaaatccttgatcatcaagat
ggtaatatagaagatgatgggcttacaggactcttaaggcttgcaacaagtgttattaaa
cacaaaccaccctttaaattttcaagagaaggacaggaatttttaagagatatcttcaat
ctcctgttcttgttgcctagtctaaaagacagacaacagccaaagtgcaaatcacattct
tccagagctgctgcttatgatttgttagtagagatggtgaagggatctgttgaaaactac
aggctaatacacaactgggttatggcacaacacatgcagtcccatgcaccttataaatgg
gactactggcctcacgaagatgttcgtgctgagtgtagatttgttggcctgactaacctc
ggagctacttgttacttggcttctactattcagcaactttatatgatacctgaggccaga
caggctgtcttcactgcaaagtattcagaagatatgaagcacaagaccactcttctggag
cttcaaaaaatgtttacatatttaatggagagtgaatgcaaagcatataatcctagaccc
ttttgtaaaacatacaccatggacaagcagcctctgaatactggggagcagaaggatatg
acagaattttttactgatctgattactaaaattgaggaaatgtctccagaactgaaaaat
accgtcaaaagtttgtttggaggtgtaattacaaacaatgttgtgtccttggattgtgaa
cacgttagtcagactgctgaagaattttatactgtgaggtgccaagtggctgatatgaag
aacatttatgaatctcttgatgaagttactattaaagacactttagaaggtgacaacatg
tatacttgttctcattgtgggaagaaagtacgagctgaaaaaagggcatgttttaagaaa
ttgcctcgcattctgagttttaatactatgagatatacatttaatatggtaacaatgatg
aaagagaaagtgaacacacacttttccttcccattacgtttggatatgacgccctataca
gaagattttctaatggggaagagtgataggaaagaaggttttaaggaagtcagtgatcat
tcaaaagatacagagagctatgagtatgacttaataggagtaactgttcatacaggaaca
gcagatggtgggcactattatagcttcatcagagatatagtcaatccacatgcttataaa
aacaataaatggtatctttttaatgatgctgaggtaaaaccttttgattctgctcagctg
gcctctgaatgttttggcggggagatgacgaccaagacctatgattctgttacagataaa
tttatggatttctcctttgaaaagacacatagtgcttatatgctgttttacaaacgcatg
gaaccagaggaagaaaatggcaaagaattcaaatttgatgtttcgtcagagttactagag
tggatttggcatgataacatgcagtttcttcaagacaaaaacattttcgaacatacatat
tttgggtttatgtggcagttatgtagttgtattcccagtacattaccagatcctaaagct
gtttccctaatgacagcaaagttaagcacttcctttgtcctagagacgtttatacattca
aaagaaaagcccacaatgcttcagtggattgaactcctgaccaaacaatttaataatagt
caagcagcttgtgagtggtttttggaccgtatggctgatgatgactggtggccaatgcag
atactaattaagtgccctaatcaaattgtgagacagatgtttcagcgtttgtgtatccat
gtgattcagagacttaggcctgtgcatgctcatctttatctacaaccaggaatggaagat
gggtcagatgatatggatgcctcagtggaagatattggtggtcgttcgtgtgtcactaga
tttgtgagaactctgttattaattatggaacatggtgtaaaacctcacagtaaacatctt
acagaatactttgccttcctttatgaatttgccaaaatgggtgaagaagagagccagttt
ttgctttcactgcaagccatatctacaatggtacatttttacatgggaaccaaagggcct
gaaaatcctcaagttgaagtattatcagaggaagaaggggaagaagaggaggaggaagaa
gatattctctctctggcggaagaaaagtacaggccggctgccctggaaaaaatgatagct
ttagttgctctgttggttgaacaatctcgctcagaaaggcatttgacattatcacagact
gacatggcagcattaacaggaggaaagggattccccttcttgtttcaacatattcgtgat
ggaatcaatataagacaaacttgtaatctgattttcagcctctgtcgatacaataatcga
cttgcagaacatattgtgtctatgcttttcacatcaatagcaaagttgactcctgaggca
gccaatcctttcttcaaattgttgactatgctaatggagtttgctggtggacctccagga
atgcctccctttgcatcttacattctgcagaggatatgggaggtaattgaatacaatcct
tctcagtgtctggattggttggcagtacagacaccccgaaataaactggcacacagctgg
gtcctgcagaatatggaaaactgggtcgagcggtttcttttggctcacaattatcctaga
gtcaggacttctgcagcttatcttctggtgtcccttataccaagcaattcattccgccag
atgttccggtcaacaaggtctttgcacatcccaacccgtgaccttccactcagtccagac
acaacagtagtcctacatcaggtctacaacgtgctccttggtttgctctcaagagccaaa
ctttatgttgatgctgctgttcatggcactacaaagctagtgccctattttagctttatg
acttactgtttaatttccaaaactgagaagctgatgttttccacatatttcatggatttg
tggaaccttttccagcctaaactttctgagccagcaatagctacaaatcacaataaacag
gctttgctttcattttggtacaatgtgtgtgctgactgtccagagaatatccgccttatt
gttcagaacccagtggtaaccaagaacattgccttcaattacatccttgctgaccatgat
gatcaggatgtggtgctttttaaccgtgggatgctgccagcctactacggcattctgagg
ctctgctgtgaacagtctcctgcattcacacgacaactggcttctcaccagaacatccaa
tgggcctttaagaatcttacaccacatgccagccaataccctggagcagtagaagaactg
tttaacctgatgcagctgtttatagctcagaggccagatatgagagaagaagaattagaa
gatattaaacagtttaagaaaacaaccataagttgttacttacgttgcttagatggccgc
tcctgctggactactttaataagtgccttcagaatactattagaatctgatgaagacaga
ctacttgttgtatttaatcgagggttgatcctgatgactgagtcattcaacactctgcac
atgatgtatcatgaagccacagcttgccatgtgactggagatttagtagaacttctgtca
atattcctttcagttttgaagtctacacgcccgtatcttcagagaaaagatgtgaaacaa
gcattaatccagtggcaggagcgaattgaatttgcccataaactgttaactcttcttaat
tcgtatagtcctccagaacttagaaatgcctgtatagatgtcctcaaggaacttgtgctt
ttgagtccccatgactttcttcatactctggttccatttctacaacacaaccattgtact
tatcatcatagtaatataccaatgtctcttggaccttatttcccttgtcgagaaaatatc
aagctaataggagggaaaagcaatattcggcctccgcgccctgaactcaatatgtgcctc
ttgcccacaatggtggaaaccagtaagggcaaagatgacgtttatgatcgtatgctgcta
gactacttcttttcttatcatcaattcatccatctattatgccgagttgcaatcaactgt
gaaaaatttactgaaacattagttaagctgagtgtcctagttgcctatgaaggtttgcca
cttcatcttgcactgttccccaaactttggactgagctatgccagactcagtctgctatg
tcaaaaaattgcatcaagcttttgtgtgaagatcccgtttttgcagaatatataaagtgt
atcctgatggatgaaagaacttttctaaacaacaacattgtgtacacattcatgacacat
tttcttctaaaggttcaaggtcaagtgttttctgaagcaaactgtgccaatctgatcagc
accctaattacaaacttgataaatcagtatcagaatatgcagtctgatttcaccaaccgt
gttgaaatttccaaagcaagtgcttctttaaatggggatctgcgtgcacttgctttgctc
ctgtcagtccacactcccaagcaattaaacccagctctaattccaactctgcaagagctt
ttaagcaaatgcaggacttgtctgcagcagagaaactcactccaagagcaagaagccaaa
gaaagaaaaactaaagatgatgaaggggcaactcctgttaaaagaaggcgtgttagcagt
gatgaggagcacactgtagacagctgtatcagcgacatgaaaacagaaactagggaggtc
ctaaccccaactagcacttcagacaatgagacaagagactcttcaattattgatccagga
accgagcaagatcttccttcccctgaaaatagttctgttaaagaatatcgaatggaagtt
ccatcttcgttttcagaagacatgtcaagtatcaggtcacagcatgcagaagaacagtcc
aacgaaggtagatttgaagactgtaaagagttcaaggacctccactgttccaaggattct
aacctagctgaggaagagtctgagttcccttctacttctatctctgcagttctctctgac
ttagctgacttgagaagctgtgatggtcaagctttgccctcccaggaccctgaggctgct
ctatcactcagttgtggccattccagaggactctttagtcacatgcagcaacacgacatt
ttagatactctgtgtaggaccattgaatctacaatccatgtgatcacaaggatatctggc
aaaggaaaccaagctgcttcttga

DBGET integrated database retrieval system