KEGG   Felis catus (domestic cat): 101084277Help
Entry
101084277         CDS       T02385                                 

Gene name
USP34
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101084277 (USP34)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101084277 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A3
AA seq 3458 aa AA seqDB search
MVCGSFQNTVAELLSCERDLSDIEGGDGLQLRKEHTLKIFAYINSWTQRQCLCCFKEYKH
LEIFNQVVCALINLVIAQVQVLRDQLCKHCTTINIDSTWQDESNQVEEPLSIERECNEGS
TERQKSIEKKSNSTRICNLTEEESSKSCDPFSLWSTDEKEKLLLCVAKIFQIQFPLYTAY
KHNTHPTIEDISTQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPE
TLPFLIAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADL
MWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVS
DTETSIAKELADWLISNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAA
AQLKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQTLYLASMLIKALWNNA
LAAKAQLSKQSSFASLLNTNLPIGNKKEEEELRRAAPSPWSPAASPQSSDNSDTHQSGGS
DIEMDEQLINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNS
SHASQSAGSPGSEVQSEDIADIEALKEEDEDDDHGHNPPKSSCGTDLRNRKLESQAGICL
GDSQGPSERSGTSNGTGKDLVFNTDSMPSVDNRIRMLDACSHSEDREHDISGEMNAAHIA
QASQESCITRTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHHDGHMVDDMLSADDV
SCSSSQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQG
PAVHKHQFNSNAVTDINLDNVCKKGNTLLWDIVQDDDAVNLSEGLINEAEKLLCSLVCWF
TDRQIRMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMM
KLFFDNLVYYIQAVREGRQKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDIL
WHCLVEDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQ
HLCNLARLATSAYDGGSNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEK
EQEFISKCMESLMIASSSLEQESHSSLTVIERGLLMLKTHLEAFRRRFAYHLRQWQIEGT
GISSHLKALSDKQSLPLRVVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQIN
QQAQLQEFGQSSRKGEFPGGLMGPVRMISSGHELTTDYDEKALHELGFKDMQMVFVSLGA
PRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPSGKVAVED
TESLRCEELHLHAENLSRRVWELLMLLPTCPNMLMAFQNISDEQSNDGLNWKELLKIKSA
HKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQVENSKNSWSCKFVAAGGL
QQLLEIFNSGILEPKEQESWTVWQLDCLACLLKLICQFAIDPSDLDLAYHDVFAWSGIAE
SHRKRTWPGKSRKAAGDHAKGLHIPRLTEVFLVLVQGTSLIQRLMSVTYTYDNLAPRVLK
AQSDHRSRHEVSHYSMWLLVSWAHCCSLVKSSLADSDHLQDWLKKLTLLIPETAVRHESC
NGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIREFLRDIFNLLFLLPSLK
DRQQPKCKSHSSRAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWDYWPHEDVR
AECRFVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLELQKMFTYLM
ESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKIEEMSPELKNTVKSLFGGV
ITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKK
VRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSD
RKEGFKEVSDHSKDTESYEYDLIGVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFND
AEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEEENGKE
FKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPSTLPDPKAVSLMTAKLS
TSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQI
VRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDASVEDIGGRSCVTRFVRTLLLIM
EHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLS
EEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSRSERHLTLSQTDMAALTGGK
GFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLT
MLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWV
ERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQVY
NVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLS
EPAIATNHNKQALLSFWYNVCADCPENIRLIVQNPVVTKNIAFNYILADHDDQDVVLFNR
GMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFIA
QRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAFRILLESDEDRLLVVFNRGL
ILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERI
EFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPMS
LGPYFPCRENIKLIGGKSNIRPPRPELNMCLLPTMVETSKGKDDVYDRMLLDYFFSYHQF
IHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLLC
EDPVFAEYIKCILMDERTFLNNNIVYTFMTHFLLKVQGQVFSEANCANLISTLITNLINQ
YQNMQSDFTNRVEISKASASLNGDLRALALLLSVHTPKQLNPALIPTLQELLSKCRTCLQ
QRNSLQEQEAKERKTKDDEGATPVKRRRVSSDEEHTVDSCISDMKTETREVLTPTSTSDN
ETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDMSSIRSQHAEEQSNEGRFEDCK
EFKDLHCSKDSNLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEAALSLSCGHSR
GLFSHMQQHDILDTLCRTIESTIHVITRISGKGNQAAS
NT seq 10377 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtggctcctttcaaaatactgtggctgagctgcttagttgtgaaagagactta
tcagatatagaaggtggtgatggactgcagctcagaaaggaacatactctcaaaatattt
gcttatatcaattcctggacacagaggcaatgtctatgctgcttcaaggaatataagcat
ttggagatttttaaccaagtagtgtgtgcacttattaacttagtgattgcccaagttcaa
gtactccgggaccagctttgtaaacattgtactactattaacatagattccacgtggcaa
gatgagagtaatcaagtggaagaaccactgagtatagaaagagagtgtaatgaaggaagt
acagaaagacaaaaatcaatagaaaaaaaatcaaactctacaagaatttgtaatctgact
gaggaggaatcttcaaagagttgtgatccttttagtttatggagtacagatgagaaggaa
aaactcttactatgtgtggcaaaaatttttcaaattcagtttcctttatataccgcgtac
aagcataatactcatcctactatagaggatatatcaacccaagaaagcaacatattaggg
gcattctgtgatatgaatgatgtagaagtaccattgcatttgcttcgttatgtatgtttg
ttttgtgggaaaaatggcctttctctcatgaaggattgctttgaatatggaactcctgaa
actttgccatttcttatagcacatgcatttattacagttgtatctaatattagaatatgg
ctacatatccctgctgtcatgcagcacattatcccctttaggacctatgttattaggtat
ttatgcaagctctctgatcaggagttaagacagagtgcggctcgcaacatggctgactta
atgtggagcacagtgaaagaaccattggatacaacattatgctttgataaagaaagttta
gatcttgcatttaagtactttatgtcaccaactctgactatgaggttggctggactaagt
cagataacgaatcaacttcataccttcaatgatgtatgcaataatgaatccttggtatca
gacacagaaacgtccattgcaaaagaacttgcagactggctaataagcaacaatgtggta
gagcatatatttggaccaaatttacatattgagattatcaaacagtgccaagtgattttg
aacttcttggcagcagaagggagactgagtactcagcatattgattgcatatgggctgca
gcacagttgaaacattgtagtcggtacatacatgacttatttccttcactcatcaagaat
ttggatccagtgccacttagacatctccttaatctggtctcagctcttgagccaagtgtt
catactgaacagaccctatacttggcatcgatgttaattaaagcattatggaacaatgca
ctagcagctaaggctcagctgtctaaacagagttcttttgcatcattattaaatactaat
cttcccattggaaataagaaagaggaagaagagctcagaagagcagccccatcaccttgg
tcacctgctgctagtcctcaaagcagtgataacagtgatacacatcaaagtggaggcagt
gacattgaaatggatgagcaacttattaatagaacgaaacatgtccaacaacgactttct
gacacagaggaatctatgcagggaagttctgatgaaactgccaacagtggtgaagatgga
agcagtggtcctggtagcagtagtgggcatagcgatggatctagcaatgaggtgaattct
agccatgccagccagtccgctgggagccctggcagtgaggtacagtcagaagacattgca
gatattgaagcccttaaagaagaagatgaagatgatgatcatggtcataatcctcctaaa
agcagttgtggtacagatcttcggaacagaaagttagaaagccaagcaggcatttgctta
ggggattcccaaggcccatcagaaagaagtgggacaagcaatggaacaggaaaggacctg
gtttttaacactgattcaatgccttcagtagataatcgaatacgaatgctagatgcctgt
tcacactctgaagatcgagaacatgatatttcaggggaaatgaatgctgctcatatagca
caagcatctcaggaatcttgtattacacgcactggggactttcttggggagactattggg
aatgaattatttaattgtcggcagtttattggtccacagcatcaccaccaccaccaccac
catcatcatcaccaccatgatgggcatatggttgatgatatgctaagtgcagatgatgtc
agttgcagtagctcccaggtcagtgcaaaatcagaaaaaaatatggctgattttgatggt
gaagaatctgggtgtgaagaggaactagttcagattaattcacatgcagagctaacatct
catctccaacaacatcttcccaatttagcatctatttaccatgaacatcttagtcaagga
cctgcagttcataaacatcaattcaacagtaatgctgtgacagacattaatttggataac
gtttgcaagaaaggaaacactttgttgtgggatatagttcaagatgatgatgcggttaat
ctttctgaaggattaataaatgaagcagagaagcttctctgttccttagtatgttggttt
acggatagacagattcgaatgagattcattgaaggttgccttgaaaatttaggaaacaac
agatcagtagtaatttcacttcgtcttcttccaaagttgtttggtacttttcagcagttt
ggaagcagttatgatacacattggattacaatgtgggcagaaaaagaactgaacatgatg
aagcttttctttgataatttggtatactatattcaagctgtaagagaaggaagacaaaaa
catgcgctgtacagccatagtgccgaagttcaagttcgacttcagttcttgacttgtgtg
ttttcaactctgggatcacctgatcatttcaggttaagtttagagcaagtcgacatttta
tggcattgtttagtagaagattctgagtgttatgatgatgcacttcattggtttttaaat
caagttcgaagtaaagatcaacatgccatggggatggaaacctacaaacatcttttcctg
gagaagatgccccagctaaaacctgaaacaattagcatgactgggttaaacctgtttcag
catctctgtaacttggctcgactggcgaccagtgcctatgatggtggttcaaactctgag
ctttgtggtatggaccaattttggggcattgctctaagagcacagtctggtgatgtcagt
cgagcagctatccagtatattaactcctattatattaatggtaaaacgggtttggagaag
gagcaagaatttattagtaagtgtatggagagtcttatgatagcttctagcagtcttgaa
caggaatcacactcaagtctcactgttatagaaagaggactccttatgctgaagacacat
ctggaagcatttaggagaaggtttgcctatcatctcagacagtggcaaattgaaggcact
ggtattagtagtcatttgaaagcactgagtgacaaacagtccctgccgctaagggtcgta
tgccagccagccggacttcctgacaagatgactattgaaatgtatcctagtgaccaggta
gcagatcttagggctgaagtaactcattggtatgaaaatttacagaaagaacaaataaat
caacaagctcagcttcaggagtttggtcaaagcagtcgaaagggagagtttcctggaggc
cttatgggacctgtcaggatgatttcatctggacatgagttaacaacagattatgatgaa
aaagcacttcatgagcttggttttaaggatatgcagatggtatttgtatctttgggtgca
ccaagaagagaacggaaaggggaaggtgttcagctgcctgcatcttgcctaccaccccct
cagaaggacaacattcctatgcttttgcttttacaagaacctcatttaactactcttttt
gatttattagagatgcttgcatcatttaaaccaccctcaggaaaagtggcagtggaagat
actgagagcttaagatgtgaagaacttcatcttcatgcagaaaatctctctaggcgtgta
tgggagctactgatgcttcttcctacatgtcctaatatgttgatggcattccagaatatc
tcagatgaacagagtaatgatggacttaattggaaagaacttctcaaaattaagagtgct
cacaagctattatatgccctggaaattattgaagcactgggaaaacctaacaggaggata
aggagagagtcaacgggaagttacagtgatctttatccagattcagatgattcaagtgag
gatcaagtggaaaatagtaaaaattcctggagttgcaagtttgttgctgctggagggctt
caacagttattggaaatttttaattctggaattctggagcctaaagagcaggaatcctgg
actgtgtggcagctagactgtcttgcttgcttgctgaagttaatatgccagtttgcaata
gatccatctgatttggatttagcttatcacgatgtctttgcctggtctggtatagcagaa
agccataggaaaagaacttggcctggtaaatcaagaaaggctgctggtgatcatgccaag
ggtcttcatataccaagattaacagaggtatttcttgttcttgtccaaggaaccagtttg
attcagcgacttatgtctgttacttatacatatgataatctggctcctagagttttgaaa
gctcagtctgatcacaggtctaggcatgaagtttcacattattcaatgtggctcttggtg
agttgggcacattgctgttcattagtgaaatctagccttgctgatagtgaccatttacaa
gattggttaaagaaattgactctccttattcctgagactgctgtccgtcatgagtcttgc
aatggtctttataagttatctctgtcagggctggatggaggagactcaatcaatcggtcc
tttctgctattggctgcttcaacattgttgaaatttcttcccgatgctcaagcgctcaaa
cctatcagggaatttttaagagatatcttcaatctcctgttcttgttgcctagtctaaaa
gacagacaacagccaaagtgcaaatcacattcttccagagctgctgcttatgatttgtta
gtagagatggtgaagggatctgttgaaaactacaggctaatacacaactgggttatggca
caacacatgcagtcccatgcaccttataaatgggactactggcctcacgaagatgttcgt
gctgagtgtagatttgttggcctgactaacctcggagctacttgttacttggcttctact
attcagcaactttatatgatacctgaggccagacaggctgtcttcactgcaaagtattca
gaagatatgaagcacaagaccactcttctggagcttcaaaaaatgtttacatatttaatg
gagagtgaatgcaaagcatataatcctagacccttttgtaaaacatacaccatggacaag
cagcctctgaatactggggagcagaaggatatgacagaattttttactgatctgattact
aaaattgaggaaatgtctccagaactgaaaaataccgtcaaaagtttgtttggaggtgta
attacaaacaatgttgtgtccttggattgtgaacacgttagtcagactgctgaagaattt
tatactgtgaggtgccaagtggctgatatgaagaacatttatgaatctcttgatgaagtt
actattaaagacactttagaaggtgacaacatgtatacttgttctcattgtgggaagaaa
gtacgagctgaaaaaagggcatgttttaagaaattgcctcgcattctgagttttaatact
atgagatatacatttaatatggtaacaatgatgaaagagaaagtgaacacacacttttcc
ttcccattacgtttggatatgacgccctatacagaagattttctaatggggaagagtgat
aggaaagaaggttttaaggaagtcagtgatcattcaaaagatacagagagctatgagtat
gacttaataggagtaactgttcatacaggaacagcagatggtgggcactattatagcttc
atcagagatatagtcaatccacatgcttataaaaacaataaatggtatctttttaatgat
gctgaggtaaaaccttttgattctgctcagctggcctctgaatgttttggcggggagatg
acgaccaagacctatgattctgttacagataaatttatggatttctcctttgaaaagaca
catagtgcttatatgctgttttacaaacgcatggaaccagaggaagaaaatggcaaagaa
ttcaaatttgatgtttcgtcagagttactagagtggatttggcatgataacatgcagttt
cttcaagacaaaaacattttcgaacatacatattttgggtttatgtggcagttatgtagt
tgtattcccagtacattaccagatcctaaagctgtttccctaatgacagcaaagttaagc
acttcctttgtcctagagacgtttatacattcaaaagaaaagcccacaatgcttcagtgg
attgaactcctgaccaaacaatttaataatagtcaagcagcttgtgagtggtttttggac
cgtatggctgatgatgactggtggccaatgcagatactaattaagtgccctaatcaaatt
gtgagacagatgtttcagcgtttgtgtatccatgtgattcagagacttaggcctgtgcat
gctcatctttatctacaaccaggaatggaagatgggtcagatgatatggatgcctcagtg
gaagatattggtggtcgttcgtgtgtcactagatttgtgagaactctgttattaattatg
gaacatggtgtaaaacctcacagtaaacatcttacagaatactttgccttcctttatgaa
tttgccaaaatgggtgaagaagagagccagtttttgctttcactgcaagccatatctaca
atggtacatttttacatgggaaccaaagggcctgaaaatcctcaagttgaagtattatca
gaggaagaaggggaagaagaggaggaggaagaagatattctctctctggcagaagaaaag
tacaggccggctgccctggaaaaaatgatagctttagttgctctgttggttgaacaatct
cgctcagaaaggcatttgacattatcacagactgacatggcagcattaacaggaggaaag
ggattccccttcttgtttcaacatattcgtgatggaatcaatataagacaaacttgtaat
ctgattttcagcctctgtcgatacaataatcgacttgcagaacatattgtgtctatgctt
ttcacatcaatagcaaagttgactcctgaggcagccaatcctttcttcaaattgttgact
atgctaatggagtttgctggtggacctccaggaatgcctccctttgcatcttacattctg
cagaggatatgggaggtaattgaatacaatccttctcagtgtctggattggttggcagta
cagacaccccgaaataaactggcacacagctgggtcctgcagaatatggaaaactgggtc
gagcggtttcttttggctcacaattatcctagagtcaggacttctgcagcttatcttctg
gtgtcccttataccaagcaattcattccgccagatgttccggtcaacaaggtctttgcac
atcccaacccgtgaccttccactcagtccagacacaacagtagtcctacatcaggtctac
aacgtgctccttggtttgctctcaagagccaaactttatgttgatgctgctgttcatggc
actacaaagctagtgccctattttagctttatgacttactgtttaatttccaaaactgag
aagctgatgttttccacatatttcatggatttgtggaaccttttccagcctaaactttct
gagccagcaatagctacaaatcacaataaacaggctttgctttcattttggtacaatgtg
tgtgctgactgtccagagaatatccgccttattgttcagaacccagtggtaaccaagaac
attgccttcaattacatccttgctgaccatgatgatcaggatgtggtgctttttaaccgt
gggatgctgccagcctactacggcattctgaggctctgctgtgaacagtctcctgcattc
acacgacaactggcttctcaccagaacatccaatgggcctttaagaatcttacaccacat
gccagccaataccctggagcagtagaagaactgtttaacctgatgcagctgtttatagct
cagaggccagatatgagagaagaagaattagaagatattaaacagtttaagaaaacaacc
ataagttgttacttacgttgcttagatggccgctcctgctggactactttaataagtgcc
ttcagaatactattagaatctgatgaagacagactacttgttgtatttaatcgagggttg
atcctgatgactgagtcattcaacactctgcacatgatgtatcatgaagccacagcttgc
catgtgactggagatttagtagaacttctgtcaatattcctttcagttttgaagtctaca
cgcccgtatcttcagagaaaagatgtgaaacaagcattaatccagtggcaggagcgaatt
gaatttgcccataaactgttaactcttcttaattcgtatagtcctccagaacttagaaat
gcctgtatagatgtcctcaaggaacttgtgcttttgagtccccatgactttcttcatact
ctggttccatttctacaacacaaccattgtacttatcatcatagtaatataccaatgtct
cttggaccttatttcccttgtcgagaaaatatcaagctaataggagggaaaagcaatatt
cggcctccgcgccctgaactcaatatgtgcctcttgcccacaatggtggaaaccagtaag
ggcaaagatgacgtttatgatcgtatgctgctagactacttcttttcttatcatcaattc
atccatctattatgccgagttgcaatcaactgtgaaaaatttactgaaacattagttaag
ctgagtgtcctagttgcctatgaaggtttgccacttcatcttgcactgttccccaaactt
tggactgagctatgccagactcagtctgctatgtcaaaaaattgcatcaagcttttgtgt
gaagatcccgtttttgcagaatatataaagtgtatcctgatggatgaaagaacttttcta
aacaacaacattgtgtacacattcatgacacattttcttctaaaggttcaaggtcaagtg
ttttctgaagcaaactgtgccaatctgatcagcaccctaattacaaacttgataaatcag
tatcagaatatgcagtctgatttcaccaaccgtgttgaaatttccaaagcaagtgcttct
ttaaatggggatctgcgtgcacttgctttgctcctgtcagtccacactcccaagcaatta
aacccagctctaattccaactctgcaagagcttttaagcaaatgcaggacttgtctgcag
cagagaaactcactccaagagcaagaagccaaagaaagaaaaactaaagatgatgaaggg
gcaactcctgttaaaagaaggcgtgttagcagtgatgaggagcacactgtagacagctgt
atcagcgacatgaaaacagaaactagggaggtcctaaccccaactagcacttcagacaat
gagacaagagactcttcaattattgatccaggaaccgagcaagatcttccttcccctgaa
aatagttctgttaaagaatatcgaatggaagttccatcttcgttttcagaagacatgtca
agtatcaggtcacagcatgcagaagaacagtccaacgaaggtagatttgaagactgtaaa
gagttcaaggacctccactgttccaaggattctaacctagctgaggaagagtctgagttc
ccttctacttctatctctgcagttctctctgacttagctgacttgagaagctgtgatggt
caagctttgccctcccaggaccctgaggctgctctatcactcagttgtggccattccaga
ggactctttagtcacatgcagcaacacgacattttagatactctgtgtaggaccattgaa
tctacaatccatgtgatcacaaggatatctggcaaaggaaaccaagctgcttcttga

DBGET integrated database retrieval system