KEGG   Felis catus (domestic cat): 101084701Help
Entry
101084701         CDS       T02385                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
fca  Felis catus (domestic cat)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101084701 (HADHA)
   01212 Fatty acid metabolism
    101084701 (HADHA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101084701 (HADHA)
   00650 Butanoate metabolism
    101084701 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    101084701 (HADHA)
   00071 Fatty acid degradation
    101084701 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    101084701 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101084701 (HADHA)
   00310 Lysine degradation
    101084701 (HADHA)
   00380 Tryptophan metabolism
    101084701 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101084701 (HADHA)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     101084701 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101084701 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A3
AA seq 763 aa AA seqDB search
MVASRAIGSLRRFTASRTLRCPGYTCRNFSASSALLTRTHINYGVKGDVAVVRINSPNSK
VNTLSRELQSEFVEVMNEIWANDQIRSAVLISSKPGCFIAGADINMLASCKSAEEVTQVS
QEGQRMFEKLEKSTKPIVAAISGSCLGGGLELAISCQYRIATKDRKTVLGSPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPSEERTIEYL
EEVAVTFAKELSDKKISLKRDKGLVEKLTSYAMSIPFVRQQIYKKVEEKVRKQTKGLYPA
PLKIIDAVKTGIEQGNDAGYVSESQKFGELAMTKESKALMGLYHGQVLCKKNKFGTPQKD
VKHLAILGAGLMGXGIAQVSVDKGIKTILKDATLAGLDRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLNVKHRVLKEVEAVVPDHCVFASNTSALP
IRQIASVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTTASVVAVGLKQGKVIVVVK
DGPGFYTTRCLAPMMSEVLRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
EDLGKAFGERFEGGSVELLKQMVSRGFLGRKSGKGFYIYQEGVKNKSLNSDMDGILASLK
VPPKSDVCSDEDLQYRLVTRFVNEAIMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRY
VDLYGAQKIVDRLRKYEAAYGKPFTPCQLLIDHANSPSKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctcccgggcgataggcagtctccgccgcttcactgcctccaggacgcttcgc
tgcccaggttatacctgccgcaacttttcagcatcctctgctttgctaaccagaacccat
attaactatggagtcaaaggggatgtggctgttgttcgaattaactcacccaattcaaag
gtaaatacactgagcagagaactgcaatcagagttcgtagaagtaatgaatgaaatctgg
gctaatgatcaaatcagaagtgccgtccttatctcatcaaagccaggctgctttattgca
ggtgctgacatcaacatgttagcctcttgtaagagcgcggaagaggtaacgcaggtatcg
caggaaggccagagaatgtttgagaaacttgagaagtccacaaagcctattgtggctgcc
atcagtggatcctgcttaggaggaggacttgagcttgccatttcctgccaatacagaata
gccacaaaagataggaaaacagtattaggtagccctgaagtcttgctggggatcttacca
ggagcaggaggcacacaaaggctgcccaaaatggtgggtgtgcctgctgcttttgacatg
atgttgactggtagaaacattcgtgcagacagagcaaagaaaatggggctagttgaccaa
ttggtggaacccctgggaccaggactaaaaccttcagaggaacggacaattgaatatcta
gaagaagttgcagttacttttgccaaagaactatctgataagaaaatctctctaaagaga
gacaaaggattagtagaaaaattgacatcatatgccatgagcattccatttgtcaggcaa
cagatttataaaaaggtggaagaaaaagtacgaaaacagaccaaaggcctttatcctgca
cctctgaaaataattgatgcggtaaagactggaattgagcaagggaatgatgctggctat
gtctctgaatctcagaaatttggagagcttgcaatgaccaaagaatcaaaggccttgatg
ggactttatcatggtcaggtcctgtgtaagaagaataaatttggaactccgcagaaggac
gtgaagcacctagccattcttggtgcggggctgatggggnccggcatcgcccaggtgtct
gtggataagggcataaagaccatccttaaagatgctacactagccggactggaccgagga
cagcaacaagtgttcaaaggattgaatgataaagtgaagaagaaagctctaacatcattt
gaaagggactccattttcagcaacttgactggacagctcgattaccagggttttgaaaag
gccgacatggtgattgaagctgtttttgaggatcttaatgttaaacacagagtgttaaag
gaagtagaagcggtggttccggatcactgtgtctttgccagtaacacgtctgctctcccc
atccgtcaaattgcctctgtcagcaaaagacctgagaaggtgatcggcatgcactacttc
tctccggtggacaagatgcagctgctggagattatcacaaccgagaaaacttctaaggac
acaactgcctccgtcgtggcagtcgggctcaagcaggggaaggtcatcgttgtggtgaag
gacggacctggcttctataccacccggtgtctcgcacccatgatgtctgaagtcctccga
atcctccaggaaggagttgaccctaagaagctggattcccttaccacaagctttggcttt
cccgtgggtgctgccacactggtcgatgaagttggcgtggacgtggcaaaacacgtggca
gaagatctaggcaaagcctttggggagcggtttgaaggtggaagcgtagaactgctgaag
cagatggtgtccaggggcttcctaggtcgcaagtctgggaagggcttttacatctaccag
gagggcgtgaagaataagagtttgaattctgacatggatggtattttggcaagtctgaag
gtgcctcctaagtctgacgtctgctctgatgaagacctccagtaccgcctggtgacaaga
tttgtgaatgaggccatcatgtgcctgcaggaagggatcctggccacgcccgcagaggga
gacatcggagccgtcttcgggcttggctttcccccgtgccttggagggcccttccgctat
gtggatctgtatggcgcccagaagatagtggacaggctcaggaagtacgaggctgcctac
ggaaaaccgttcaccccgtgccagctgctcatcgaccacgctaacagccccagcaagaag
ttctaccagtga

DBGET integrated database retrieval system