KEGG   Felis catus (domestic cat): 101084918Help
Entry
101084918         CDS       T02385                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
fca  Felis catus (domestic cat)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101084918 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101084918 (SPHK1)
   04020 Calcium signaling pathway
    101084918 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    101084918 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    101084918 (SPHK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     101084918 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
E1
AA seq 487 aa AA seqDB search
MPESAAPRARPEDLAGRCPSLGAARDSASAVSSPSDPAAAGDDAGTSAAPTPGGKGEPLS
PHRVARLGGTDKELKAGAAAAGSPPTALGTPWQREPRDEVMDPAGGGGSLLPERCRVLVL
LNPRGGKGKALQLFWSHVQPLLAQAGISFTLMLTERRNHARELVQGLELGRWDALVVMSG
DGLMYEVVNGLMERPDWETAIRKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTL
LLCRRLLEPMNLLSLQTASGLRLFSVLSLSWGFIADVDLESEKFRRLGELRFTLGTFLRL
AALRVYRGRLAYLPAGRGVPGVPASPAVDRQDQQGPTDAHLVPLEEPVPAHWTVVPEQDF
VLVLALLHSHLGSEMFAAPMGRSAAGTMHLFYVRAGVSRATLLRLFLAMEKGKHLEQACP
YLVYAPVVAFRLEPKDGKGVFAADGELLVSEAVQGQVHADYIWMVSGCVEPPPGQKPRRG
SPPEKPL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgccagagagcgcggctccccgcgcgcggcccgaggatctagctgggcgctgcccatct
ctgggggccgcccgggactccgccagcgctgtctcctctccctcagatcccgcagccgca
ggggatgacgccggtacctccgcggccccgactccgggcgggaagggcgagcccctcagc
ccgcaccgcgtcgcccgcctgggcggcaccgataaggagctgaaggcaggagccgccgcc
gcgggcagccccccaacagcgctggggacgccctggcagcgggagccgcgagacgaggtt
atggatccagcgggaggcggcgggagcctgctgcccgagcggtgccgcgtgctggtcctg
ttaaacccgcgcggaggcaagggcaaggcgctgcagctcttctggagccacgtgcagccc
ctgctggcccaggccggcatctccttcacgctgatgctcactgagcgtcggaaccacgct
cgggagctggtgcaggggttggagctggggcgctgggacgccctggtggtcatgtctgga
gacgggctgatgtacgaggtggtgaacgggctcatggagcggcccgactgggagactgcc
atccggaagcccctgtgtagcctcccggctggctccggcaacgccctggcagcttctttg
aaccattatgccggctatgagcaggtgaccaacgaggacctcttgaccaactgcaccctg
ctgctgtgccgccggctgctggagcccatgaacctcctgtcactgcagaccgcctcgggg
ctgcgcctcttctccgtgcttagcctgtcttggggcttcatcgctgatgtggatctggag
agcgagaagtttcggcgcctcggggagctccgcttcactctgggcaccttcctgcgcctg
gcggcgctgcgcgtgtaccggggccgactggcctacctgcccgcaggaaggggggtcccc
ggggtgcccgcctcccctgcggtggaccggcaggaccagcagggccctacggacgcacac
ctcgtacccctggaggagccggtgcccgcgcactggacggtggtgccggagcaggacttc
gtgctggtgctggcgttgctgcactcgcacctgggcagcgagatgttcgctgccccgatg
ggccgctctgccgccggcaccatgcacctgttctacgtgcgggcgggcgtgtctcgggcc
acgctgctgcgcctcttcctggccatggagaaggggaagcacttggagcaggcctgtccc
tacttggtgtacgcgcccgtggtcgccttccgcctggagcccaaggatgggaagggtgtg
tttgccgccgacggggagttgttggtcagcgaggctgtgcaaggccaggtgcacgcggac
tacatctggatggtcagtggctgcgtggagcccccacccggccagaagcctcggcgggga
tcacctccagaaaagcccttatga

DBGET integrated database retrieval system