KEGG   Felis catus (domestic cat): 101084979Help
Entry
101084979         CDS       T02385                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
fca  Felis catus (domestic cat)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101084979 (RPA2)
   03420 Nucleotide excision repair
    101084979 (RPA2)
   03430 Mismatch repair
    101084979 (RPA2)
   03440 Homologous recombination
    101084979 (RPA2)
   03460 Fanconi anemia pathway
    101084979 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 270 aa AA seqDB search
MWFGGSESYGASFGGVGGGYTQSPGGFGMPTPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGKVEISQVTIVGIIRHAEKAPTNIVYKVDDMTAAPMDVRQWVDTDDASSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVVNAHMILSKANSQPLAGR
ATISNPGMGEAGNFGGNSAIPANGLTVAQNQVLSLIKACPRPEGLNFQDLKNQLQHMSVA
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttggcggatctgaaagctatggcgcttcctttggcggagtcggcggcggctac
acacagtccccgggaggcttcggaatgccgacaccttcccaggctgaaaagaaatcaaga
gcccgagcccagcacattgtaccctgtaccatatctcagctgctttctgccaccctggtc
gatgaagtgttcagaattgggaaggttgagatttcacaggtcactattgtgggtatcatc
agacatgcagagaaggctccaaccaacattgtttacaaagtagatgacatgacagctgca
cccatggatgttcgccagtgggttgacacagatgatgccagcagtgaaaacaccgtggtt
cctccagaaacgtatgtaaaagtggctggccatctgagatcctttcagaacaaaaaaagc
ctggtagcctttaagatcatgcctctggaggacatgaatgaattcaccacacatattctg
gaagtagtcaacgcacacatgatcctgagcaaagctaacagccagcccttagcagggaga
gcaactatcagcaatccaggaatgggtgaagcagggaactttggtgggaatagcgccata
ccagcaaatggcctcactgtggcccaaaaccaggtgctgagtttgattaaggcttgtcca
agaccagaaggattaaactttcaggatctcaagaaccagctccagcacatgtctgtagcc
tcaataaagcaagctgtagattttcttagcaacgagggacacatctattccactgtggac
gacgatcactttaaatccacagatgcagagtaa

DBGET integrated database retrieval system