KEGG   Felis catus (domestic cat): 101085008Help
Entry
101085008         CDS       T02385                                 

Gene name
TK2
Definition
(RefSeq) thymidine kinase 2, mitochondrial isoform X7
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00240  Pyrimidine metabolism
fca00983  Drug metabolism - other enzymes
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101085008 (TK2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101085008 (TK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101085008 (TK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_33 AAA_18 AAA_17 Thymidylate_kin CoaE TsaE
Motif
Other DBs
NCBI-GeneID: 101085008
NCBI-ProteinID: XP_006941633
Position
E2
AA seq 245 aa AA seqDB search
MTTALRQSIWVFLSGSASGDKDRENEKEKKSVICVEGNIASGKTTCLEFFSKTTGIEVLQ
EPVPKWRNVRGHNPLGLLYRDACRWGFTLQTYVQLTMLDHHTRPQTSPVRLMERSIHSAR
YVFVENLYRSGKMPEVDYVILAEWFDWIVRNIDVSIDLIVYLRTTPETCYKRLQMRCREE
ETVISLEYLDALHRLYEEWLFKGGLFPVAAPVLVIEADHDRKKMLELFEQNRDRILTPEN
QKRGS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgctctcaggcagtccatatgggttttcctgtctgggagtgcttccggagat
aaagatagagaaaatgaaaaagagaaaaaatcagtgatctgtgttgagggcaatattgca
agtgggaagacgacatgcctcgagttcttctccaaaacaacagggattgaggtgttacag
gagccagtgcccaagtggagaaatgtccgtggccataatcctctgggtctgctgtaccgc
gatgcttgtcgatggggcttcacgctgcagacatatgtgcagctcacgatgctggaccac
cacactcgtccccagacatcaccggtacgattgatggagcggtcgattcacagcgcaaga
tatgtttttgtagaaaacctgtatagaagtgggaagatgcctgaagtggactatgtgatt
ctggcagaatggtttgattggatcgtgaggaacatcgacgtgtccattgatttgatagtt
tatctccggaccacccctgagacctgttataagaggttacagatgagatgcagggaggag
gaaacagtcatttccttggaatacttggatgctcttcaccgcctctatgaggagtggctc
ttcaaaggaggccttttccctgtggcagcccctgttctggtgattgaggctgaccacgac
cggaagaaaatgttagaactctttgaacaaaaccgggaccgcatactaactccagagaat
cagaaacgtggctcatag

DBGET integrated database retrieval system