KEGG   Felis catus (domestic cat): 101085008Help
Entry
101085008         CDS       T02385                                 

Gene name
TK2
Definition
thymidine kinase 2, mitochondrial
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fca  Felis catus (domestic cat)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101085008 (TK2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101085008 (TK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101085008 (TK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E2
AA seq 245 aa AA seqDB search
MTTALRQSIWVFLSGSASGDKDRENEKEKKSVICVEGNIASGKTTCLEFFSKTTGIEVLQ
EPVPKWRNVRGHNPLGLLYRDACRWGFTLQTYVQLTMLDHHTRPQTSPVRLMERSIHSAR
YVFVENLYRSGKMPEVDYVILAEWFDWIVRNIDVSIDLIVYLRTTPETCYKRLQMRCREE
ETVISLEYLDALHRLYEEWLFKGGLFPVAAPVLVIEADHDRKKMLELFEQNRDRILTPEN
QKRGS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgctctccggcagtccatatgggttttcctgtctgggagtgcttccggagat
aaagatagagaaaatgaaaaggagaaaaaatcagtgatctgtgttgagggcaatattgca
agtgggaagacgacatgcctcgagttcttctccaaaacaacagggattgaggtgttacag
gagccagtgcccaagtggagaaatgtccgtggccataatcctctgggtctgctgtaccgc
gatgcttgtcgatggggcttcacgctgcagacatatgtgcagctcacgatgctggaccac
cacactcgtccccagacatcaccggtacgattgatggagcggtcgattcacagcgcaaga
tatgtttttgtagaaaacctgtatagaagtgggaagatgcctgaagtggactatgtgatt
ctggcagaatggtttgattggatcgtgaggaacatcgacgtgtccattgatttgatagtt
tatctccggaccacccctgagacctgttataagaggttacagatgagatgcagggaggag
gaaacagtcatttccttggaatacttggatgctcttcaccgcctctatgaggagtggctc
ttcaaaggaggccttttccctgtggcagcccctgttctggtgattgaggctgaccacgac
cggaagaaaatgttagaactctttgaacaaaaccgggaccgcatactaactccagagaat
cagaaacgtggctcatag

DBGET integrated database retrieval system