KEGG   Felis catus (domestic cat): 101085008Help
Entry
101085008         CDS       T02385                                 

Gene name
TK2
Definition
thymidine kinase 2, mitochondrial
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fca  Felis catus (domestic cat)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fca00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:fca00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E2
AA seq 351 aa AA seqDB search
MPDATQRAAPLSSAGYKHSCLACGCPSHSPPSGLNPKVLQASGISCGGVEGRGQSLAATP
DPSRPPVGGRQWVRPWGSGPSLFGAGEPYREQKDPLSPRVRAAPVPVPLLVLILLALGKT
EAGSCNKDRENEKEKKSVICVEGNIASGKTTCLEFFSKTTGIEVLQEPVPKWRNVRGHNP
LGLLYRDACRWGFTLQTYVQLTMLDHHTRPQTSPVRLMERSIHSARYVFVENLYRSGKMP
EVDYVILAEWFDWIVRNIDVSIDLIVYLRTTPETCYKRLQMRCREEETVISLEYLDALHR
LYEEWLFKGGLFPVAAPVLVIEADHDRKKMLELFEQNRDRILTPENQKRGS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgccacgcagcgggcagccccactgtcctctgcgggctataagcacagctgc
ctggcctgcggctgcccgtctcactccccgccgtctggcctgaacccgaaagtactccaa
gcctccgggatttcctgcgggggcgtggaggggcgagggcagtcgttggcagctactccg
gaccccagccggccgccagtaggtggccgccagtgggtgaggccgtggggctccggcccc
tctctgttcggagctggggagccctatagagagcagaaggatccgctatccccgcgagtg
cgcgctgccccagtccccgtcccactcctggtcctgattcttttggccttggggaagacg
gaggctggcagctgcaataaagatagagaaaatgaaaaggagaaaaaatcagtgatctgt
gttgagggcaatattgcaagtgggaagacgacatgcctcgagttcttctccaaaacaaca
gggattgaggtgttacaggagccagtgcccaagtggagaaatgtccgtggccataatcct
ctgggtctgctgtaccgcgatgcttgtcgatggggcttcacgctgcagacatatgtgcag
ctcacgatgctggaccaccacactcgtccccagacatcaccggtacgattgatggagcgg
tcgattcacagcgcaagatatgtttttgtagaaaacctgtatagaagtgggaagatgcct
gaagtggactatgtgattctggcagaatggtttgattggatcgtgaggaacatcgacgtg
tccattgatttgatagtttatctccggaccacccctgagacctgttataagaggttacag
atgagatgcagggaggaggaaacagtcatttccttggaatacttggatgctcttcaccgc
ctctatgaggagtggctcttcaaaggaggccttttccctgtggcagcccctgttctggtg
attgaggctgaccacgaccggaagaaaatgttagaactctttgaacaaaaccgggaccgc
atactaactccagagaatcagaaacgtggctcatag

DBGET integrated database retrieval system