KEGG   Felis catus (domestic cat): 101085029Help
Entry
101085029         CDS       T02385                                 

Gene name
SETD2
Definition
SET domain containing 2
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101085029 (SETD2)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101085029 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 2548 aa AA seqDB search
MLSWLDGNREEENEAKIENVQKTGFFKGPMFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLQNRFLTALGNEKQNDTPNSPAGPLQVDLTPKIKMDVGDTLSTTEESSPPKS
RVELGKIHFKKHLLHVTSRPLLTTATAVVSPPPPVVPLPAVIAESTTVDSPPSSPPPPPP
PPQATTPSPAPVTEPVALPHTPIPVLMTAPVDVAVRTLKEPPVTTVPESSDVDTKQDAVS
NSSEEHITQNLNEQADTPSQKEDSHIGKEEEIPDSSKSNLGSKKTGSKKKSSQSEGTFLA
SESDEDSVRTSSSQRSHDLKFSASIEKERDSKKSLAPLKSEDLGKSSRSKTERDDKYFSY
SKLERDTRYISSRCRSERERRRSRSRSRSDRGSRTSLSYSRSERSHYYDSDRRYHRSSPY
RERARYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSFSYRDLRTSSSYSKSDRDCKTES
SYLEMEKRGKYSSKVERESKRTSENEAMKRCCSPPNELGFRRGSSYSKHDNSASRYKSAL
SKSVSKSDKFKNSFCCTELNEEIRSSHSFNLQAPCSKGSELRMISKIPEREKTGSPSPSN
RLNDSPTFKKLDESLIFKSEFIGHDSHDSIKELDSLSKVKNDQLRSYCPIELNINGSPGA
ESDLATFCTSKTDTVLMSSDDSVTGSEVSPLVKACMLSSNGFQNINRCKEKDSDNTCMLR
SKSGSPFRETEPTVSPHQDKLMSLPVTTIDYSKTVIKEPVDMAVSCCKTKDSDLYCTSND
NNPSLRHSEAEKIEPSVMKISSNSFMNVHLKSKTVICDNRNLTDQHSKFAREEYKQSVGS
TSSASVNHFDDIYQPIESSGVASSLQSLPPGVKVDSLTLLQCGENASPVLDAVLKSKSTE
FVKHAEKETIIEVGSDLPDSGRGFASWENRHNNGLSGKCVQEAQEEGSSIVLERRGRSEI
SLDEEGGRGHAHTSDDSEVVFSSCDLNLTMEDSDGITYTLKCDSSGHASEIVSTVHEDYS
GSSESSSDESDSEDTDSDDSSFPRNRLQSVVVVPKNSTLPTEETSPCSSRSSQSYRHYSD
HWEDERLESRRHSYEEKYDSVASKPCSQTEKFFHHKGTEKNPEISFTHPSRKQIDNHLSE
IVHPQSDGVDSTSHTDVKSDFLGHPNSEETAKAKIASRQQEELPVYSSDDFEDIPNKSRQ
QTIFPNRPDSRLGKTELSFSSSCEISRVDGFRSSEELRNLGWEFSQQEKPTTTYQQPDSS
YGACGGHKYQQSAEHYGGTRNYWQGNGYWDPRSAGRPPGTGVVYDRIQGQVPDSLTDDRE
EEDSWDQCAGSHFSSQSSKFFLSLQKDKGSVQAPEISSNSIKDSLAVNEKKDLSKNLEKN
DMKDRGPPKKRRPELESDSESDGELQDRKKVRVAVEQGETALPPGSALVGPSCVMEDFRD
PQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECAPLSKDERAQGEIAC
GEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFV
LEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCE
TQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVS
IRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLE
LIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLE
ESKVLPIIQRWSQTKTAIPPLSEGDGYSSENTSRAHTPLNTPDPSTKLSTEADTDTPKKL
MFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLEHVPVEDEEELQSQQLLTQQLPES
KVESEIAMEASKLPISEPEADAEIEPKEGNGTKLEETIAEETPSQDEEEGVSDVESERSQ
EQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTITERGRDAVGFRDQTAAPKT
PNRSRERDPDKQTQNKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKL
STEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAY
VDPSNPNAGKVLLPTPSMDPVCSPAPYDHSQPLVGHSTEPLAAPPPVPVVPHVAAPVEVS
SSQYVAQSDGVVHQDSSVTVLPVPAPGPVQGQNYGVWDSNQQSVSVPQQYSPAQSQATIY
YQGQTCPAVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPAAAVTAIV
TPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQ
WDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRK
EMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENV
KHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7647 nt NT seq  +upstreamnt  +downstreamnt
atgctctcttggctggatggcaatagagaagaagaaaatgaggcaaagattgaaaatgtg
cagaaaacaggtttcttcaaaggaccaatgttcaaaggtgttgcttctagtcgattttta
cctaaaggcaccaagacaaaagttaatttggaggaacagggacgacaaaaggtgtctttc
agcttcagccttacaaagaaaactttgcagaataggtttctgactgcacttggcaatgaa
aagcaaaatgatactccaaactccccagctggacctcttcaagtagacttgactcctaaa
attaaaatggacgttggagataccttatctactacagaagaatcttccccaccaaaatca
agggtagaattgggcaaaattcattttaagaaacacctgcttcatgtgacgtccaggcca
ctgctgactacagccacagcagtggtgtctccacctcctccagtagtaccattaccagca
gtcatagcagaatcaacaactgtagattcaccaccctcttctccacctccaccacctcca
cctccccaggccacgacaccctcaccagcaccagtaacagagccagtggccttgccacac
acaccaatcccagttctgatgacagcaccggtagatgtagcagttagaacactgaaggaa
ccaccagttacgactgtaccagaatcttcagacgtggacactaagcaggacgctgtatct
aatagttcagaagaacacataactcagaatttgaatgagcaagcagatactccctcacaa
aaagaagattcccatattgggaaggaagaagaaattccagatagttctaagagtaatctg
ggctctaaaaaaacaggttctaagaagaaatcctcacaatccgaaggcacctttcttgct
tcagaatctgatgaagattctgtacggacttcctcaagtcaaagatcacacgatttaaaa
ttttcagcaagcattgaaaaggaaagagattcaaaaaagagcttagcacctttaaaaagt
gaggatttagggaaatcttcacgatctaaaacagagagagatgataaatattttagctac
tcaaaacttgaaagagatactcggtatatatcttctcgatgtagatcagagagagagcga
aggcggagcagatctcgttcaagatctgacagaggctctagaactagtttatcctattcc
cggtcggaacgatcccattattatgactctgatcgtcgctaccatcggagttccccttac
cgagagagggctcgctattctcggccatatacagataacagagctcgggagagttctgac
tcagaagaggagtataagaagacctactcaaggcgcacctcatcccattccttctcttac
agagacctaaggacatcatcatcctattctaaatctgatcgggactgcaaaactgagtcc
tcttacttagagatggagaaaagaggaaagtattcttcaaaagtagaaagagaatccaaa
aggacttcagaaaatgaagcaatgaaaagatgttgttctccccctaatgaactgggattc
cgacggggctcatcctattccaagcatgataacagtgcttcccgttacaaatctgccctt
tcaaagtctgtatccaagtccgataaatttaagaattctttctgttgtacagaattaaat
gaggaaatcagatcatctcattcttttaatttacaggctccttgttcaaaaggtagtgaa
ttaagaatgattagtaaaattcctgaaagagaaaagactgggtctccatcaccatcaaat
cgattaaatgattcacctacttttaaaaagctagatgaatcccttatttttaaatctgaa
tttataggacatgatagccatgatagtattaaggaattagactctttatctaaagtgaag
aatgatcagttaagaagttattgtcccatagaattaaatataaatggatctcctggggca
gaatctgatttggcaacattttgcacttctaaaactgacactgttttgatgtcttctgat
gatagtgtgactggatcagaggtatcccctttggtcaaagcatgcatgctttcatcaaat
ggatttcagaatattaatagatgtaaagagaaagactcagacaatacatgcatgctgcgt
agtaagtcaggaagcccatttagagaaacagaacctacagtgtcgccacaccaagataaa
ctcatgtctttgccagttacgactatagattattccaaaactgtaattaaagaaccagtc
gatatggcagtttcttgttgtaaaaccaaagattcagatctatactgtacttcaaatgac
aacaacccttctttgcgtcattctgaagctgaaaagattgagccttcggttatgaagatt
tcttcaaatagctttatgaatgtgcatttgaaatcaaaaacagttatatgcgataataga
aatctgacagatcagcactcaaaatttgcacgtgaagaatataagcagagcgttggtagc
accagttcagcttctgttaatcattttgatgacatatatcaaccgatagagagttcaggc
gttgcttcatctcttcagagtctgccaccaggagtaaaagtggacagtttaactctctta
caatgtggagagaacgcatctccagttttggatgctgtgctgaagagtaaaagcacagag
tttgtaaagcatgcagagaaagaaaccatcatagaagtaggtagcgaccttcctgattca
ggaaggggatttgcctcttgggaaaacaggcataataatgggctctctgggaaatgtgtg
caagaggctcaagaagaagggagttccatagtgcttgagagaagaggaaggtcagaaatc
tctttagatgaagaaggagggagaggacatgctcatacttctgatgactcagaagttgta
ttttcttcttgtgacttgaatttaaccatggaggacagtgatggcataacatatacctta
aaatgtgacagtagtggtcacgcctcagagatcgtatccactgtccatgaagattattct
ggttcttctgaaagctcaagtgatgaaagtgactctgaagatacagattctgatgatagc
agttttccaagaaaccgtcttcagtctgttgtggtagtcccaaagaattctactttgccc
acggaagaaaccagtccgtgttcttctcggagtagtcaaagttacagacactattctgac
cactgggaagatgagagattggagtcgaggagacattcatatgaggaaaaatatgacagt
gtagcaagtaaaccctgttctcagactgagaagttcttccatcataaaggaacagagaag
aatccggaaatttcttttacacaccccagcagaaaacagatagataaccacctgtctgaa
attgttcatcctcagagtgacggggttgatagtacaagtcatacagatgtgaaatctgac
tttctaggtcatccaaattctgaggaaacagcaaaagccaaaatagcctctaggcagcaa
gaagagctgccagtttattcttctgacgattttgaagacatcccgaataagtctcggcaa
caaaccattttccctaacaggccagatagtagactgggaaaaacagagttgagtttttct
tcctcttgtgagatctcccgagtggatggcttccgctcatcagaagagctcaggaaccta
gggtgggaattctctcaacaagaaaagcctactaccacatatcagcaacctgacagcagc
tatggagcctgtggtggacacaagtatcagcaaagtgcagaacattatggtgggacacgt
aattactggcaaggtaacggctactgggatccaagatcagcaggtagacctcctggaaca
ggggttgtgtatgatcgaattcaagggcaggtaccagattccttaacagatgaccgtgaa
gaggaggacagttgggatcaatgtgcagggtctcacttttcaagccagtccagtaaattt
tttctatctcttcagaaggacaaggggtccgtgcaggcacctgaaataagcagcaattcc
attaaggactctttagctgtgaatgaaaagaaagatctttcaaaaaacttagaaaaaaat
gatatgaaagatagaggacctcctaaaaaaaggagaccggaattggagagtgattctgaa
agcgatggtgaacttcaggacagaaagaaagttcgagtggcagtagagcagggagaaacg
gcattgcccccaggctcagcactggttgggccttcctgtgtcatggaggatttcagggac
ccacagcgatggaaagaatgtgccaagcaagggaagatgccctgttactttgatctgatt
gaagaaaatgtttatttaacagaaagaaagaagaataaatcacatcgggatattaagcga
atgcagtgtgagtgtgcacctctttctaaagatgaaagagcgcaaggtgaaatagcatgt
ggggaagattgtcttaatcgactcctcatgattgaatgttcttctcggtgtccgaatggg
gattattgttccaatagacggtttcagagaaaacagcatgcagatgtggaagtcatactc
acagaaaagaaaggctggggcttgagagctgcgaaagaccttccttcgaacacctttgtc
ctggaatattgtggagaggtacttgatcataaagagtttaaagcccgggtaaaggagtat
gcacgaaacaaaaacatccactactatttcatggccctgaagaatgatgagataatagat
gccactcagaaaggaaactgctctcgtttcatgaatcacagctgtgaaccaaactgtgag
actcaaaaatggactgtgaacggacaactgagggtcgggttttttaccaccaaattagtt
ccttcaggctcggagttaacatttgactatcagttccaaagatatggaaaagaagctcag
aaatgtttctgtgggtcagctaattgccgaggttacctgggaggagagaatagagtcagt
atcagagcagcaggaggaaaaatgaagaaggaacgatctcgtaagaaggattcagtggat
ggagagctagaagctctgatggagaatggtgagggtctctctgataaaaaccaggtgctc
agcttatcccggctaatggttagaattgaaactttggagcagaaacttacctgtcttgag
ctcatacagaacacgcattcacagtcttgcctgaagtcctttctggaacgtcatgggctg
tctttgttgtggatctggatggcagagctaggtgatggccgggaaagtaaccagaagctt
caagaagagattataaagactttggaacacttacccattcctactaaaaatatgttggag
gaaagcaaagtacttccaattatccaacgctggtctcagaccaaaactgccattcctccg
ttgagtgaaggagatgggtattcaagtgagaatacgtcacgtgctcacacaccactcaac
actcctgatccttccaccaagctaagcacagaagctgacacagatacccccaagaagctc
atgtttcgcagacttaaaattataagtgaaaatagcatggacagtgcaatatctgatgct
accagtgagctggaaggcaaggatggcaaagaggaccttgaccagttagaacacgtccct
gtagaagacgaggaagagttacagtcacaacagctactcacacaacagctgcctgagtct
aaagttgagagtgaaattgccatggaagccagtaagctacccatatctgaaccagaggct
gatgctgaaatagagcctaaagagggcaatggcacgaaactggaagaaacaattgctgag
gaaacaccatcccaagatgaagaggagggtgtatctgatgtggagagtgagaggagccag
gaacagccagataaaacagtagatataagtgatttggccaccaagctcctggatagttgg
aaagacctaaaggaggtttatcgaattccaaagaaaagtcaaactgaaaaggagaacaca
ataactgaacgaggaagggatgctgttggcttcagagatcaaacagctgccccaaagact
cctaacaggtcaagagagagagacccagacaagcaaactcaaaataaagagaaaaggaaa
cgaaggggctctctctcaccaccttcttctgcctatgagcggggaacaaaaaggccagat
gacagatatgatacaccaacttctaagaagaaagtacgaattaaagaccgcaataaactt
tctacagaggagcgccggaagttgtttgagcaagaggtggctcagcgggaggctcagaaa
caacagcagcagatgcagaacctgggaatgacatctccactgccctatgactctctgggc
tacaatgcccctcatcacccctttgctggctacccaccaggttatcccatgcaggcctat
gtggatcccagcaaccctaatgctggaaaggtgctcctccccacacctagcatggacccc
gtgtgttctcctgctccttatgatcattctcagcccttggtgggacattctacagaaccc
cttgctgcccctccacctgtaccagtggtgccacatgtggcagcccctgtggaagtttcc
agttcacagtatgtggcccaaagtgatggtgtggtacaccaagactccagcgtcaccgtc
ttgccagtgccagccccaggcccagttcagggacagaattatggtgtttgggattcaaac
caacagtctgtcagtgttccccagcagtattctcctgcacagtctcaagcaaccatatat
tatcaaggacagacttgtccagctgtctatggtgtgacatcaccctattcacagacaact
ccaccaattgtgcagagttatgcccaaccaagtcttcagtacatccaaggacagcagatt
ttcacagctcatccgcaaggcgtggtcgtacagccagctgcagccgtgactgcgatagtc
acaccagggcagcctcagcccttacagccgcctgaaatggtagtgacaaataatcttctg
gatctgccacccccctctcctcccaaaccaaaaaccattgtcttacctcccaactggaag
acagcccgagatccagaagggaagatttattactaccacgtgatcacaaggcagactcag
tgggatcctcctacttgggaaagcccaggagatgatgccagccttgagcatgaagctgag
atggacctggggaccccaacgtatgatgaaaaccccatgaagacatcaaaaaagcctaag
acagcagaagcagacacctccagtgagctggctaagaaaagcaaagaagtattcagaaaa
gagatgtcccagttcattgtccagtgcctgaacccttaccggaaacctgactgcaaagtg
ggaagaatcaccacaactgaagacttcaaacacctagctcgcaagctgactcacggcgtt
atgaataaggagctgaagtactgtaagaaccctgaggacctggagtgcaatgagaatgtg
aaacacaaaaccaaggagtatattaagaagtacatgcagaagtttggggctgtttacaaa
cccaaagaggacactgaattagagtga

DBGET integrated database retrieval system