KEGG   Felis catus (domestic cat): 101085041Help
Entry
101085041         CDS       T02385                                 

Gene name
GSTA4
Definition
(RefSeq) glutathione S-transferase alpha 4
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101085041 (GSTA4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101085041 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    101085041 (GSTA4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101085041 (GSTA4)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101085041 (GSTA4)
  Drug resistance
   01524 Platinum drug resistance
    101085041 (GSTA4)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101085041 (GSTA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B2
AA seq 222 aa AA seqDB search
MAAKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIAEKHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKVLRDHGQRFLVGNQLSLADVILLQTILALEEKIPNILSAFPH
LQEFTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNIFMP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagcccaagctccactatcccaacggaagaggccggatggagtccgtaaga
tgggttttagctgccgctggagtcgagtttgatgaagaattcttagaaacaaaagaacag
ttacagaagttgcaggatggtaaccacctgctgttccagcaagtgccaatggttgaaatt
gacgggatgaagttggtgcagacccgcagcatccttcactacatagcagagaagcaccac
ctgtttggcaaggatctcaaggagagaaccctgattgacatgtatgtggaggggacgcta
gatctgctggaactgattatcatgcatcctttcctaaaaccagatgatcaacaaaaggaa
gtggttaacatggcccagaaggctataattagatactttcctgtgtttgaaaaggtttta
agggatcatgggcaaaggtttcttgttggtaaccagctgagccttgcggacgtgattcta
ctccaaaccattttggctctagaagagaaaatccccaatatcctgtctgcatttcctcac
ctccaggagttcacagtgaaaatcagtaatatccctacaattaagaaattccttgaacct
ggcagcaagaagaagcctcctccagatgacatctacgtgagaaccgtctacaacatcttt
atgccctaa

DBGET integrated database retrieval system