KEGG   Felis catus (domestic cat): 101085296Help
Entry
101085296         CDS       T02385                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 858 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDTTTGTGDPPRKKPTRLAIGVEGGFDLSEEKYEYDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FNLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
NYPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESSVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKLPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVSTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctgtcagtattaccgacgatccgggttcctaag
gctggagaccgggtccacaaagacgagtgcgccttctccttcgacacaccggagtctgag
ggtggcctctacatctgcatgaacacattcctgggctttgggaaacagtatgtggagaga
catttcaacaagaccggccagcgcgtctacctgcacctccggaggacccggcgcccgaaa
gaggaggacaccacgacaggcactggagaccccccccgaaagaagcccacccggctggct
attggtgttgaaggcgggtttgacctcagcgaggagaagtatgaatatgatgaggatgtg
aagattgttattttgccggattacctggagattgcccgagatgggttggggggactgcct
gacattgtcagagaccgggtgaccagtgcggtggaggccctactgtcagccgactcggcc
tcccgcaagcaggaggtgcaggcctgggatggggaagtacggcaggtgtctaagcatgcc
ttcaacctcaagcagctggacaaccctgctcgaatccctccctgcggctggaagtgttcc
aagtgtgacatgagagagaacctgtggctcaacctgacagacggctccattctctgtggc
cgccgctacttcgatggcagtgggggcaacaaccacgccgtggaacactacagagagacc
aactacccgctggccgtcaagctgggcaccatcacacctgatggagccgatgtgtactcc
tatgatgaggatgacatggtcctggaccccaacctggctgagcacctgtcccacttcggc
atcgacatgctgaagatgcagaagacggacaagaccatgactgagttggagatagatatg
aaccagcggattggcgaatgggagctgatccaggagtcgagtgtgccactgaagcccctg
tttgggcctggctacacgggcatccggaacctgggtaacagctgctacctcaactccgtg
gtccaggtcctcttcagcatccccgacttccagaggaagtatgtggacaagctggagaag
atctttcagaatgccccgacggaccctacccaggacttcagcacccaggtggccaaactg
ggccatggccttctctcgggagaatattccaagccagcaccggagtcaggcgatggggag
caggtgccagaacaaaaggaagttcaagatggcattgcccctcggatgttcaaggccctc
attggcaagggtcaccccgagttctccaccaaccggcagcaggatgcccaggagttcttt
cttcacctcatcaacatggtggagaggaattgccggagctctgaaaatcctaacgaagtg
ttccgcttcttggtggaggaaaagatcaagtgcctggccacagagaaggtgaagtacacc
cagcgagtggactacatcatgcagctgcctgtgcccatggacgcggcccttaacaaagag
gagcttctggagtatgaggaaaagaagcggcaagccgaagaggagaagctgccactacca
gaactggttcgggcccaggtgcccttcagctcctgcctggaggcttatggggcccccgag
caggtggacgacttttggagcactgccctgcaggccaaatcggtagccgtcaagaccaca
cgatttgcctctttccctgactacctggtcatccagatcaagaagttcacctttggcttg
gactgggtgcccaagaaactggatgtgtccattgagatgcccgaggaactagacatctcc
cagttgaggggtacagggctgcagcctggagaggaggagctgcctgacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcacccatgttggacgagtccgtcatt
atccagctggtggagatgggcttccctatggacgcctgccgcaaagccgtctactacaca
ggcaacagtggggctgaggccgccatgaactgggtcatgtcacacatggacgatccagat
ttcgcaaaccccctcatcctgcctggctccagcgggcctggctccaccagtgcggcagct
gaccccccgccggaagactgcgtgagcaccatcgtctccatgggcttctcccgggaccag
gccctgaaagctcttcgggccacgaacaatagtttagaaagggctgtggactggatcttc
agtcacattgatgacctggatgcggaagccgccatggacatctcggagggccgctcggct
gctgactccatctccgagtctgtaccagtgggacctaaagtccgggatggccctggaaag
tatcagctctttgccttcatcagccacatgggcacctctaccatgtgtggtcactatgtc
tgccacatcaagaaggaaggcagatgggtgatctacaatgaccagaaagtgtgtgcctct
gagaagccgcccaaggacctgggctacatctacttctaccagagagtggccagctaa

DBGET integrated database retrieval system