KEGG   Felis catus (domestic cat): 101085301Help
Entry
101085301         CDS       T02385                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101085301 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 665 aa AA seqDB search
MQQERTVRLQYGSRVEAVYVLGTHLWTDVYSAAPAEAQTFSLKHSERVRVEVVRDGQAEE
VAANGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYEEEGSMPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPRKASWTWGPEGQGAILLVNCDRDTPWLPKEDLNDEKVYSKEDLKD
MSQMILRTKGPDRLPVGYEIVLYISMTDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLRFPDEGFPGLVSIHVSLLEYMAEEIPLTPIFTDTVVFRIAPWIMT
PNILPPLSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYVNRGDRWIQDEVEFGYIEA
PHKGFPVVLDSPRDGYLKDFPMKQLLGPDFGYVTREPLYEPVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLQAQQVQAPVELYSDWLTVGHVDEFMTFVP
IPGTKQFRLLMASTSACYKLFREKQREGHGEAIMFKGLGGMSSKRITINKILSSESLVQE
NQYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEKRQARAYFPNMVNMIVLDKDLGI
PKPFGPQVEEVCCLETHVRSLLEPLGLCCTFVDDISAYHKFLGEVHCGTNVRRKPFAFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggagcggaccgtgcggctgcagtacgggagccgcgtggaggcggtgtacgtg
ctgggcacgcacctctggaccgatgtctacagtgcggcccccgccgaggcccagaccttc
agcctgaagcactcagagcgcgtgcgggtagaggtggtgcgtgacgggcaggccgaggag
gtggccgccaacggcaaacagcgctggcttctgtcgcccagcaccacgctgcgggtcact
atgagccaggccagcaccgaggccagcagcgacaaggtcaccgtcaactactacgaggag
gaggggagcatgcccattgaccaggctgggctcttcctcacggccatcgagatctccctg
gatgtggacgcagaccgggacggcgtggtggagaagaacaacccaagaaaggcatcctgg
acgtggggccctgagggccagggggccatcctgctggtgaactgtgatcgagacacgccc
tggttgcccaaggaggatttgaacgacgagaaggtctacagcaaggaagacctcaaggac
atgtcccagatgatccttcggaccaaaggcccagaccgcctccccgtgggatatgagatc
gttctctacatttccatgacagactcggacaaagtgggcgtgttctacgtggagaatcct
ttcttcggccagcgttacatccacatcctgggccgacggaagctctaccacgtggtcaag
tacacgggcggctccgcagagctgctgttctttgtggaaggcctgcgttttcccgacgag
ggcttcccgggcctggtgtccatccacgtcagcctgctggagtacatggccgaggagatt
cccctgacacctatcttcacggacaccgtggtgttccggattgctccgtggatcatgacc
cccaacatcctgcctcccttgtcagtgttcgtgtgctgcatgaaggacaattacttgttc
ctgaaagaggtgaagaacctggttgagaaaaccaactgtgaactaaaggtctgcttccag
tatgtgaatcgaggcgaccgctggatccaggatgaagttgagtttggctacatagaggcc
ccccataaaggcttccctgtggtactggactccccccgagatggatacctgaaggacttc
ccaatgaagcagcttctgggcccagatttcggctacgtgacccgggagcccctctatgag
cctgttaccagcctcgattcctttgggaacctggaggtcagtccaccagtgactgtcaac
ggcaagacataccccctgggccggatcctcatcggaagcagctttcctctgtccggtggt
cggaggatgaccaaggtggtgcgggacttcctgcaagcccagcaggtgcaggcacccgtg
gagctctactcagactggctgaccgtgggccacgtcgatgagttcatgaccttcgtcccc
atcccaggcacaaagcaattccggctgctcatggccagtacctcggcctgctacaagctc
ttccgagagaagcaaagggagggccacggggaggccatcatgttcaaaggcttgggcggg
atgagcagcaagcgaatcaccatcaacaagattctgtccagcgagagtctcgtgcaagag
aaccagtacttccagcgctgcctggactggaaccgtgacatcctcaagaaggagctgggg
ctgacagagcaggacatcatcgatctgcccgctctgttcaagatggatgagaaacgccag
gccagagcctacttcccaaatatggtgaacatgattgtgctggacaaggacctgggcatc
cctaagccgttcgggccccaggtggaggaggtatgctgcctggagacacacgtgcgctcc
ctgctggagcccctgggcctctgctgcaccttcgtggatgacatttcggcctaccacaag
tttctgggcgaagtccactgcggcaccaacgtccgcaggaagcccttcgccttcaagtgg
tggcacatggtaccctga

DBGET integrated database retrieval system