KEGG   Felis catus (domestic cat): 101085377Help
Entry
101085377         CDS       T02385                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B2
AA seq 814 aa AA seqDB search
MRVKEPSKALPEKAKRSKRPAIPRDEDSSDDIAVGFTCPHVNLAISVNHVKKAIAENVWS
VCSDCLRERRFCDGQPVLSSDIWLCLKCGFQGCGRNSESHHSVKHYKNQRTESHCITISL
STWIIWCYECDEKLSTHCNKKVLAQTVDFLQKHVSKTQTSAFSRILKLCEEKYEAGEKKK
GRKGNSVTPVKGITNLGNTCFFNAVMQNLAQSYILSELMNESKENGTKLKIFPSSDSHLD
PLMVELSSPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKGFQQQDSQELLH
YLLDAVRTEETKRIQAGILKAFNNPTTKTADDDTKKRSKVSYGREGVKMNFIDRIFIGEL
TSTVMCEECANISTVKDPFIDISLPIIEERVSKPVLLGRMNKCRSLQATDTGQYSDTVTI
ENVQQPRATKNQSSSKDKNQLVHGRKCVRKLPSGEDRVAVICREYENPGMSGDSSVCAGV
VSTEAALAESPTDGSEKEASPSESSADADSEASESESTSQQAVLLRSRSGCCAHKNGPPP
QRPLTKETGSGDEGVAEAISELYLSSTVTGDGDLDRENKPPDIPNNLCSSQEKYVLSPSP
QKAFLSLSQSYITTSKECSVQSCLYQFTSMELLMGNNKLLCENCTEKKQKYQKETISAEK
KAEGVYTNARKQLLISAIPANLILHLKRFHQAGLNLRKVNRHVDFPLILDLAPFCSATCK
NVNVGDKVLYGLYGVVEHSGSMRGGHYTAYVKVRAPSRKLLEHITGKKNVPDLKEPDSES
ADQWVHVSDTYVQVVPESRALSAQAYLLFYERIL
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagaaccttccaaagctttacccgagaaagcaaaaagaagtaaaaggcct
gctatacctcgtgatgaagactcttcagacgacattgctgtaggtttcacttgcccacat
gtaaatcttgccatcagtgtgaatcatgtgaagaaagcaatagctgagaatgtgtggtca
gtttgctccgactgtttaagggaaagaagattctgtgatgggcagccagtactttcctct
gacatttggttgtgcctcaagtgtggttttcagggatgcggtagaaactcagaaagccat
cattcagtgaagcactacaagaatcagagaacagaatctcattgtattacaattagtctg
agcacatggattatatggtgttatgaatgtgatgaaaaattatcaacacactgtaataag
aaggttttggctcaaacagttgattttctccagaaacatgtttctaaaacacaaacaagt
gcattctctagaatcttaaaactttgtgaagaaaaatatgaagcaggtgaaaaaaagaaa
ggaagaaaaggcaacagtgtaacacctgtgaaaggaattacaaatttaggaaatacttgc
tttttcaatgcagtcatgcagaacttggcacaatcttatattctttcagaactgatgaat
gagagcaaagaaaatggtacaaaactcaagatttttccttcctcagactctcacctggac
ccattaatggtggaactttcaagccctggaccattgacctcagccctgttcctgtttctt
catagcatgaaggagactgaaaaaggaccactttctcctaaagttctttttaatcagctt
tgtcagaaggcccctcgatttaaaggtttccagcaacaggacagtcaggagctactgcat
tatctgctggatgcggtgagaacagaagaaacaaagagaatacaagctggcatcctaaaa
gcatttaacaacccaactactaaaactgctgatgatgatactaaaaaaaggtcaaaggta
tcatatggaagagaaggtgtgaaaatgaacttcatagatcggatctttattggtgaatta
actagcacagtcatgtgtgaagaatgtgcaaatatctccacagtgaaagatccttttatt
gatatttcacttcctataatagaagaaagggtttcaaaacctgtacttttgggaagaatg
aataaatgtagaagtttacaggcaacagatactggtcagtacagtgacactgttactata
gaaaatgttcagcaacccagagccaccaagaaccagtcttcatctaaagataagaatcaa
ctagttcacggcagaaaatgtgtaagaaaattaccatctggagaagatagagtggccgtc
atatgccgagaatatgaaaaccctgggatgagtggagattcctcagtgtgtgcaggcgtc
gtgagcactgaggcagctctggccgaaagccctactgatggcagcgaaaaagaagccagc
ccttccgaaagtagtgctgatgctgacagtgaggcttcagaatcggaaagtacttctcag
caggctgtcctgttgaggtctagaagtggatgctgtgcacacaaaaatggacctcctccc
cagcggccactcaccaaggagactggcagtggtgacgagggagtggctgaagctatttct
gaactgtatttgagcagcactgtaactggagatggagatcttgacagagaaaataagcca
ccagatattccaaataatttgtgttcatcacaggagaagtatgtgttgtctcctagcccc
caaaaggcttttctttccctttctcagagctatataactacttctaaagaatgctcagtt
cagtcctgtctctaccagtttacatctatggaattactaatggggaataacaagcttcta
tgtgagaattgtactgaaaagaaacagaagtaccaaaaggaaaccatttctgcagaaaag
aaagcagaaggggtttatactaatgccaggaagcaattgctcatttctgctattccagca
aacctaattctccatcttaaaagattccatcaggctggcttgaatcttcgaaaagtaaac
agacatgtcgattttccacttattcttgatttggcaccattctgttctgctacttgtaag
aatgtaaatgtgggagataaagttctctatggtctctatggcgtagtggaacacagtggc
tcaatgagaggaggtcactacacggcttatgtgaaagtgagagcaccctccaggaaatta
ttggagcatatcactggaaagaaaaatgtacctgatttgaaagaacctgacagtgaatcg
gcagaccaatgggtccatgttagtgacacttacgtgcaagtggttccagaatcaagagca
cttagtgcacaagcataccttcttttttatgaaagaatattataa

DBGET integrated database retrieval system