KEGG   Felis catus (domestic cat): 101085487Help
Entry
101085487         CDS       T02385                                 

Gene name
AOX1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101085487 (AOX1)
   00350 Tyrosine metabolism
    101085487 (AOX1)
   00380 Tryptophan metabolism
    101085487 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101085487 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    101085487 (AOX1)
   00830 Retinol metabolism
    101085487 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101085487 (AOX1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101085487 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 1320 aa AA seqDB search
MSCPPKSDDLVFFVNGRKVIERNADPEVTLLNFLRKNLRLTGTKYACGRGGCGACTVMVS
KHDPVSAKIRHFSITACLVPICSLYGAAVTTVEGIGSINTRLHPVQERIARSHGTQCGFC
TPGMVMSMYTLLRNHLQPSEEQLMEALGGNLCRCTGYRPILASGRTFCVESTDCQKKRTG
KCCLDLGGNDSSSLSRESDICTDLFVEEEFQPLDPTQELIFPPELLRMAKNPEKQTLTFH
GERVTWISPGTLKDLLELKAKHPEAPLILGNTSLGPAMKSQGRVHPILLSPARISELSMV
FKTSDGLTIGAGCSLAQVKDILAEQVSELPEEKTQTYRALLKHLKSLAGQQIRNMASLGG
HVISRHCYSDLNPILVVGNATLNVISEEGTRQIPLNDHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVSAGMRVILEEATDTIKELSLSYGGVGESTIGAHKSC
QQLIGRPWNEPMLEEACRLLLEEVSLPGWAPGGRVEFKRTLVVSFFFKFYLEVLQELKKL
DSHHYPEISDRFLSALEDFPVTGPRGVQRYQSVDSHQSLQDPVGRPIMHLSGLKHATGEA
IFCDDIPMVDRELFMVLVTSTKAHAKIISIDLSEALELPGVVDVITAEDIPGTNGAEDDK
LLAVDEVLCVGQIICAVVAETDVQAKRAIEKIKITYKDLEPIIFTINDAIKHNSFLCPEK
KLEQGNIEEAFEKVDQIVEEVHVGGQEHFYMETQRVIVIPKAEDKELDIYVSTQDPAHVQ
KTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGRPIRLVLDREDDM
LITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSEQVTEFLILKLENAYKIRN
LRFRGRACMTNLPSNTAFRGFGFPQGTLITESCITAVAAKCGLLPEEIREKNMYKTIDKT
IYKQAFSPETLIRCWNECLDKSSFHSRRIQVEEFNKKNYWKKKGIAIIPMKFSVGFAATS
YHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKLPMSYMHICETSTATVPN
TIATAASIGSDVNGKAVQNACQILLKRLEPIIKKNPGGTWEDWIEAAFEQRISLSATGYF
RGYKADMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIIMDACCSLNPAIDIG
QVEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTITDVPEEFNGLGESGMFLGSSV
FFAITDAVAAACKERDIVEDFIVKSPATPEQVRMACADRFTEMIPRDDPQTFKPWSIPIA
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcccaccgaaatcagatgacttggttttctttgtgaatgggaggaaggtgata
gagaggaatgcggacccagaagtcactctgctgaactttctacgaaagaacttacgcctc
acaggaaccaagtatgcctgtggaagaggaggctgcggtgcctgtactgtgatggtgtcc
aagcatgacccagtgtctgcaaagataagacacttctccattactgcatgtctggtgccc
atctgctctctgtatggggctgctgtcaccactgtagaaggtattggaagtatcaacacc
aggcttcaccctgtgcaggagaggatcgccaggagccacggcacccagtgcggattctgc
acccctgggatggtgatgtccatgtacacactgcttaggaaccacctacagccttcagag
gagcagctcatggaagccctggggggtaatctatgccgctgtactgggtatcggccaatt
cttgcaagtggaaggaccttctgtgtggagtcaactgactgtcaaaagaaaagaacagga
aaatgctgcttggatctgggaggaaatgattcttcctcactcagcagggaaagtgacatt
tgcacagacttatttgtggaagaggagttccagcccttggaccctacccaggagctcata
tttcccccagaactcttgagaatggcaaagaacccagaaaaacaaaccctgaccttccat
ggagagagggttacctggatctcccctggcaccctcaaggatctcctggagctgaaagca
aaacatcctgaggcccctctcatcttgggcaacacttcactgggacctgcaatgaaatct
caaggacgtgttcacccaattctcctctctcctgctaggatttctgagctcagtatggta
tttaaaacaagtgatggactgacaataggtgctggctgcagtctggcccaagtgaaggac
attttggctgagcaagtttccgagcttccagaggagaaaactcagacataccgagccctc
ctaaagcacctgaagagtctggcaggacagcagatccggaatatggcgtccttaggggga
catgttataagccgacattgctattcggatctgaatccaattttggttgtgggcaatgct
accctcaatgtgatatcagaagaaggtacacggcagatccctctaaatgaccattttctt
gctgggttggcaagtgcagaccttaagccagaggaaattttggaatctgtgtacatcccg
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccagcaaaatgcc
ttggccgatgtgagtgctggcatgcgagtcattctcgaagaagccacagacaccatcaag
gagctgagcctctcctatggaggggttggggaatccacaattggtgcacataaatcctgc
cagcagctcatagggaggccctggaatgagccaatgctggaggaagcttgcaggctgctt
ctggaagaggtctccctcccaggctgggctccagggggaagagtggaattcaagaggact
ttggtggtcagcttcttcttcaaattctacctagaagttctgcaggaactgaagaaactt
gacagtcatcattatcctgaaatttcagaccgattcctaagtgctctagaagatttcccc
gtcacaggaccccggggagtccaaaggtaccagagtgtggattctcaccagtccctccaa
gatccagttggacgccccatcatgcacctgtcaggtcttaaacatgctacaggtgaagcc
atattttgtgatgacatccctatggtggatagagaacttttcatggttttggtgaccagt
acaaaagcccatgcaaaaatcatatcaattgatttgtctgaggcccttgaactacctggg
gtggttgatgtgataacagctgaggacattccaggcaccaatggtgccgaggatgacaaa
ttgttggctgtagatgaggtgctttgcgtgggccagatcatctgtgctgtggttgcagag
acagatgtacaggcaaagagagcaattgaaaagataaagatcacctacaaagatctggag
cccataatcttcaccatcaatgatgccataaagcacaactcattcctatgccctgaaaaa
aaacttgaacaaggaaacattgaggaggcatttgaaaaagtcgatcaaattgttgaagag
gtccatgttggaggccaggaacatttctacatggaaacacaaagagtgattgttattcca
aaggcagaggacaaagaactggacatttatgtatcaacacaggatccagcccacgtgcag
aaaacagtgtcctctactttaaatatccccatcaacaggatcacctgtcatgtcaagcgg
gtgggtggaggttttggcggaaaagtaggaagaccagctgtatttggggctattgctgct
gtgggtgctatcaaaactggtcgtcccattcgtcttgttcttgatcgtgaagatgatatg
ttaataactgggggaagacacccattatttggaaaatataaagtgggattcatgaacaac
gggcgaatcaaagctctagacattgagtgtttcattaatggaggatgcacactggatgac
tctgagcaggtaacagaatttcttatattaaagctggaaaatgcatataaaatccgcaac
cttagattccggggccgggcatgcatgacaaatttaccatccaatacggcctttcgtgga
tttggcttcccacaaggaaccctgataacagaatcttgcatcacagctgtggcagccaaa
tgtggccttctgccagaagagattagggagaaaaacatgtacaaaacaattgataaaacc
atctacaaacaagcattcagccctgagaccctgataagatgttggaatgagtgtctggac
aagtcttcctttcatagcagaagaatacaagtggaagagtttaacaagaagaattattgg
aaaaagaaaggcattgcaattatccccatgaagttttcagtcggctttgctgcaacaagc
tatcatcaggcagctgcacttgttcatatctacacagatgggtctgtattggtcacacat
ggaggcaacgaactgggacaaggtattcacaccaaaatgctgcaggtggccagccgtgaa
ttaaaactacccatgtcttatatgcacatctgtgaaacaagtacagccacggtaccaaat
acaattgctacagcagcttccattggttcggacgtcaatggcaaagccgtgcagaatgca
tgtcagatccttctgaaacgcctcgagcccatcattaagaaaaatccaggaggtacatgg
gaggactggatagaagctgcttttgaacaaagaatcagtctttcagccactggatacttc
aggggatacaaggccgacatggactgggagaagggagaaggagaccctttcccatactat
gtctatggagcagcctgttctgaggttgaaattgactgcctgacaggcgctcacaagaaa
atcagaacggacatcatcatggatgcatgttgcagcctaaatcccgccattgatattggg
caggttgaaggttcctttattcagggaatgggtctttataccaccgaagagctaaaatat
tccccagaaggtgttctgtactctcgaggcccagatgaatataaaattccaaccatcact
gacgtcccagaagagttcaatggcctgggggagtccgggatgttcttggggtcatctgtg
ttctttgccatcactgatgctgtggccgcagcatgcaaagaaagagacatagtcgaggac
ttcatagtgaagagtccagcaaccccggaacaagttcgaatggcctgtgcagatcggttc
acagagatgatcccaagagatgaccctcagacatttaaaccttggtctatccctatagcg
taa

DBGET integrated database retrieval system