KEGG   Felis catus (domestic cat): 101085554Help
Entry
101085554         CDS       T02385                                 

Gene name
PLCZ1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 isoform X1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04020  Calcium signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04114  Oocyte meiosis
fca04919  Thyroid hormone signaling pathway
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101085554 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101085554 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    101085554 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101085554 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101085554 (PLCZ1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101085554 (PLCZ1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101085554 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 EF-hand_6 EF-hand_10
Motif
Other DBs
NCBI-GeneID: 101085554
NCBI-ProteinID: XP_006933614
Ensembl: ENSFCAG00000018855
Position
B4
AA seq 630 aa AA seqDB search
MENKWFLSMIRDEFRGGKINLEKTHKLLEKLDIQCNYVHVKSIFKDNDRLKQGRITIEEF
RSIYRIIAHREEIVEIFNTYSGNQKFLVEKNLLQFLIQEQYILDMSQNIAFEIIQKYEPI
EEVKRAHRMSFEGFIRYMGSSECLIFKPDCGRVYQDMTQPLNDYFISSSHNTYLISDQLL
GPSDLWGYVSALVKGCRCLEIDCWDGSQNEPIVYHGYTLTSKLLFKTVIQAIHKYAFLTS
DYPVVLSLENHCSPSQQEVMADTLQSVFGDALLSDMLDDFPDKLPSPEVLKFKVLVRNKK
IGTLRETHERKGSNKHGQVEEFEEIYQDEIKGSETLIGSEDNPGKEDEIISVAGLPLFKK
RKVKVALALSDLVIYTKAEKFRSFQHSRLYQQFNESNSIGETEARKLLKLRAHEFVLHTR
RFITRIYPKATRTDSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILK
PQFLRDIKTQFNPNKPPNQSDPVTLTIRLISGIQLPPSNHSSSNKADALVILELFGVPND
QTKQQTRVIKRNAFSPRWNETFTFIIQVPELALMRFVVESQGLITGNEFLGQYTLPVLSM
NKGYRRVPLFSKMGESLEPASLFVYIWYVR
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaatggtttttgtcgatgattcgggatgaatttagaggtggaaaaattaac
ctagaaaaaactcacaaattacttgaaaaattagatattcagtgcaattatgttcatgtg
aaatctatttttaaggataatgacaggctgaagcaaggaagaatcaccatagaagaattt
agatcaatttatcgaattattgcgcacagagaagaaattgttgagattttcaacacgtat
tctggtaaccagaaatttcttgttgaaaaaaacctgctccaatttttgatacaagaacag
tatatacttgacatgagtcaaaatattgcttttgagatcattcagaaatatgagcctatt
gaagaagttaagagagcacatcggatgtcatttgaaggttttataagatacatgggttca
tctgaatgtctaatatttaaacctgattgtggaagagtttatcaagatatgactcaacca
ctaaatgattattttatttcaagttcacataatacctacttgatatctgaccagttactg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtctggaa
attgactgctgggatggatcacaaaatgaacctattgtataccatggttatacactcacc
agcaagcttttgtttaaaacagttatccaagcaatacacaaatatgcattcttaacatct
gactacccagtggtgctctctttagaaaatcactgctccccttcccaacaagaagtgatg
gcagacactttgcagtctgtttttggagatgccttgctttctgatatgcttgatgatttt
ccagacaaactaccttcaccagaggtattaaaattcaaagtattagttaggaacaagaaa
ataggaaccttaagggaaacccatgaaaggaaaggttctaataagcatggtcaggtagag
gaatttgaagagatatatcaagatgaaatcaaaggatcagaaacattgattggatcagaa
gacaatccaggaaaggaagatgagataataagcgtagctggattaccacttttcaagaaa
aggaaggtaaaggtggctctggccctatctgatcttgtcatttataccaaagctgagaag
ttcagaagctttcagcattcaagactgtatcagcaatttaatgaaagtaattctattggg
gaaacagaagcccgaaaacttttaaagctgagagcccacgagtttgttcttcacaccagg
aggttcattaccagaatttatcccaaagcaacaagaacagactcctctaattttaatcct
caagaattttggaatataggttgtcaaatggtggccttaaatttccagacacctggtctg
cctatggatcttcaaaatgggaaatttttggataatggtggttctggatatattttgaaa
ccacagttcctaagagatattaaaacacagtttaatccgaataaaccaccaaaccagagt
gatccagttacacttacaataaggctcatcagtggtatccagttacctcccagtaaccat
tcatcatctaacaaagctgacgcattagtgattctagaactttttggtgttccaaatgat
caaacgaaacagcagacccgtgtcattaaaagaaatgcttttagtccaagatggaatgaa
acgttcacatttattattcaagtgccagaattggcattgatgcgttttgttgttgaaagt
caaggtttaataactggaaatgaatttcttggccaatatactttaccagttttaagcatg
aacaaaggttaccgtcgtgttcctctgttttccaaaatgggcgagagtcttgagcctgcc
tcactgtttgtttacatttggtacgtcagatag

DBGET integrated database retrieval system