KEGG   Felis catus (domestic cat): 101085707Help
Entry
101085707         CDS       T02385                                 

Definition
anionic trypsin-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
fca  Felis catus (domestic cat)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101085707
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    101085707
   04974 Protein digestion and absorption
    101085707
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101085707
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101085707
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101085707
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101085707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 247 aa AA seqDB search
MTPLLILAFVGAAVAFPTDDDDKIVGGYTCEENSIPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEHNIEVLEGDEQFINSAKVIRHPRFNSWTLDYDIMLIKLSSPAALT
GQVSTISLPSACAPAGTQCLISGWGNTLSSGTNYPELLQCLDAPLLSQDQCKAAYPGQIT
ENMVCAGFLEGGKDSCQGDSGGPVVCRGELQGIVSWGYGCAQKNKPGVYTKVCNFTDWIK
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactccactcctgatccttgctttcgtgggagctgctgttgctttccccactgacgac
gatgacaagatcgttgggggctatacctgtgaggagaactccatcccctaccaggtgtcc
ctgaactcgggctaccacttctgcggcggctccctcatcagtgaccagtgggtggtgtct
gcggctcactgctacaagtctcgcatccaagtgaggctcggagagcacaacatcgaagtc
ctggagggggatgagcagttcatcaactcggccaaggtcatccgccaccccagatttaac
agctggaccctggactatgacatcatgcttatcaagctctcctcacctgcagccctcact
ggccaggtgtccaccatatcgctgccctccgcctgtgcccccgccggcacccagtgcctc
atctccggctggggcaacaccctgagctctggcaccaactaccccgagctgctacagtgc
ctggacgccccgctgctgagccaggaccagtgtaaagccgcctaccccgggcagatcacg
gagaacatggtttgcgctggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccctgtggtctgcagaggagagctccagggcatcgtctcctggggctatggctgt
gcccagaagaacaagcctggcgtctacaccaaggtgtgcaacttcacagactggattaag
gagacgatagctgccaacagctaa

DBGET integrated database retrieval system