KEGG   Felis catus (domestic cat): 101085768Help
Entry
101085768         CDS       T02385                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101085768 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
E3
AA seq 678 aa AA seqDB search
MGDSNVDASATVSETVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKDEIPEFTRIQPV
TSSVKDSSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLA
DLGSLPEIENSLAVFCMATYGEGDPTDNAQDFYDWLQETDMDLSGVKYAVFGLGNKTYEH
FNAMGKYVDKRLEQLGAQRIFELGMGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDIDVAKVYMGEMGRLKSYENQKPPFDAKNPFLAEVTTNRKLNQGTERHL
MHLELDISDSKLRYESGDHVAVYPANDSALVSQLGKILGADLDVIMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLRKMASSSGEGKELYLSWV
VEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYET
KSGRINKGVATSWLRAKEPAGENGRRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPF
IGFIQERAWLRQQGKDVGETLLYYGCRRSDEDYLYREELTQFHKDGSLTQLNVAFSREQP
HKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMARDVQNTFYDIVAEVGAMEHAQAV
DYIKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgggggattccaacgtggatgccagcgccacagtgtctgagacagtggctgaagaagtg
tctcttttcagcatgacggacatgattctgttttcactcatcgtgggcctcctgacctac
tggttcctcttcagaaagaaaaaagacgaaatccccgagttcaccagaattcagccagta
acctcctctgtcaaagacagcagctttgtggaaaagatgaagaagacgggcaggaacatc
atcgtgttctacggctcccagacggggacggcggaagagtttgccaaccgcttgtccaag
gacgcgcaccgctacgggatgcggggcatggctgcagaccccgaggagtatgacttggcc
gacctgggcagcctgccggagatcgagaactccctggcggtgttctgcatggccacctat
ggtgagggggaccccacggacaacgcacaggacttctacgactggctccaggagacggat
atggacctctccggagtcaagtatgcggtgtttggtctcgggaacaagacctacgagcac
ttcaatgccatgggcaagtatgtggacaagcggctggagcagctcggcgcccagcggatc
ttcgagctggggatgggcgatgacgatgggaacctggaggaggacttcatcacgtggcga
gagcagttctggccggctgtgtgcgaacactttggggtggaagccaccggagaggagtcc
agcattcgccagtacgagctcgtggtccacacagacatagacgtggccaaggtgtacatg
ggagagatgggccgactgaagagctacgagaaccagaaacccccctttgatgccaagaat
ccgttcttggctgaggtcaccaccaaccggaagctgaaccagggaactgagcgacacctc
atgcacctggaattagacatctcagactccaaactcaggtatgaatctggggaccatgtg
gccgtttacccagccaatgactctgccctggtcagccagctcggcaagatcttgggtgct
gacctggacgtcatcatgtccctgaacaatctggacgaggagtccaacaagaagcacccc
ttcccctgccccacctcgtaccgcacggccctcacctactacctggacatcaccaacccg
ccacgcaccaatgtgctctacgagctggcacagtacgcctcggagccctctgagcaggag
cacttgcgcaagatggcgtcctcctcgggcgagggcaaggagctgtacctgagctgggtg
gtggaggctcggcggcacatcctggccatcctgcaggattacccgtccctgcggcccccc
atcgaccacctgtgtgagctgctgcctcgtctccaggcccgctactactccatcgcctca
tcctccaaggtccaccccaactctgtgcacatctgtgccgtggcggtagagtacgagacc
aagtctggccgcatcaacaagggggtggccaccagctggctacgggccaaggagcctgca
ggggagaacggccgccgggccctggtgcccatgtttgtgcgcaagtcccagttccgcctg
cccttcaaggccaccacccctgtcatcatggtgggccctggcacaggggtggcacccttc
ataggcttcatccaggagcgggcctggctgcggcagcagggcaaggacgtgggggagacg
ctgctctactacggctgccgccggtctgacgaggactatctgtaccgcgaagagctgact
cagttccacaaggacggctccctcacccagctcaacgtggccttctctcgggagcagccc
cacaaggtctacgtgcagcacttactgaagagggacaaggagcacctgtggaagctgatc
cacgaggggggcgcccacatctacgtctgcggggatgctcggaacatggcaagggatgtg
cagaacaccttctacgacattgtggccgaggtgggggccatggagcacgcccaggccgtg
gactacatcaagaagctgatgaccaagggccgctactccctggacgtgtggagctag

DBGET integrated database retrieval system