KEGG   Felis catus (domestic cat): 101085813Help
Entry
101085813         CDS       T02385                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101085813 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C1
AA seq 657 aa AA seqDB search
MSMKRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDVYISPSVERGR
ERADARRWHFDTGLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDIALD
CDLNCEGRQNRSFVDKRQWVWGPSGYGAILLVNCDKDDANCYDQDNCDQHVHCLQDLEDM
SVMVLRTQGPAALFNDHRLILHTSSYDAKWARVFHTCGPEDSCEAYRHVLGQNKVSYEVP
HFHGDEERFFVEGLSFPDASFTGLVSFHVTLLDDSNEQVSFXPRRPLWSPDVAVSXAPLP
GLVCSVRNNTCFVDAVAELARKAGCKLTICPQNENRNDRWIQDEMELGYVQAPHKTFPVV
FDSPRNGELQDFPYKRILGPDFGYVTREPQDSSVSGLDSFGNLEVSPPVVANGKEYPLGR
ILIGGNLPGSSGRRVTQVVRDFLHAQRVQPPVELFVDWLAVGHVDEFLSFVPAPDGKGFR
MLLASPGACFKLFQEKRKWGHGRALLFKGVVGDKQISTVSINQVLSNANLISYNKFVQSC
IDWNREVLKRELGLTEQDIIDIPQLFKIERRKAVAFFPDLVNMLVLGKHLGIPKPFGPII
NGQCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRRQPFSFKWWNMVP
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaagaggattgtgcgtgtgtccctggagcatcccaccagcgccgtgtgtgtg
gctggcgtggagaccctcgtggacatttatgggtcggtacctgagggcacagagatgttc
gaggtctacgggacccccggtgtggacgtctacatctctcccagtgtggagaggggccgg
gagcgtgcagacgccagacggtggcactttgatacggggttggagatcatcgtggtcatg
aactcgcccagcaatgacctcaatgacagtcatgttcagatttcctaccactccagccac
gaaccccttcccctggcctatgcggtgctctacctcacctgtgttgacatcgctctggat
tgtgacctgaactgtgagggcagacagaacaggagcttcgtggacaagcggcagtgggtc
tgggggcccagtggctatggagccatcttgctggtgaactgtgacaaggacgatgcgaac
tgttacgaccaggacaactgtgaccagcacgtgcactgcctgcaagacctggaagacatg
tcagtcatggtcctgcggacccaaggccccgctgccctcttcaacgaccacagacttatc
ctccacacctccagctatgatgccaagtgggcccgggtcttccacacctgcggtcctgag
gactcgtgcgaggcctacaggcacgtgctgggccagaacaaggtgtcgtacgaggtgccc
cacttccacggtgacgaggagcgcttcttcgtggaggggctctccttccctgatgccagc
ttcacggggctcgtgtccttccacgtcaccctgctggacgactccaacgagcaggtgtcc
ttctgaccccggaggcccctctggtctccagacgtggctgtgtcctgagcccctctccct
gggcttgtctgcagcgtgaggaacaacacgtgttttgtggacgccgtggcggagctggcc
aggaaggctggctgcaagctgaccatctgcccgcagaacgagaaccgcaatgaccgctgg
atccaggacgagatggaactgggctatgttcaggcgccacacaagaccttcccggtggtc
tttgactcccccaggaacggagagctacaggacttcccttacaaaaggatcctgggtcca
gatttcggctatgtgacgcgggaaccacaagacagctctgtgagtggcctggactccttc
gggaacctggaggtcagccccccagtggtggccaatgggaaagagtaccccctggggcgg
atcctcatcgggggcaacctgcctgggtccagtggccgccgggtcacgcaggtggtgcgg
gacttcctccacgcgcagagggtgcagcccccagtggagctctttgtggactggttggcc
gtgggccacgtggatgagtttctgagctttgtccctgcccccgacgggaagggcttccgg
atgctcctggccagtcctggcgcctgcttcaagctcttccaggaaaagcggaaatggggc
cacggcagggccctcctgttcaaaggggttgtcggtgacaagcagatcagcaccgtctcc
atcaaccaggtcctctccaatgcaaacctcatcagctacaacaagtttgtgcagagctgc
atcgactggaaccgggaggtactcaagcgggagctgggcctgaccgagcaggacatcatc
gacatccctcagctcttcaagattgagaggagaaaggcagtggccttcttccctgacttg
gtgaacatgttggtgctggggaagcacctgggcatccccaagcccttcgggcccatcatc
aacggccaatgctgcctggaggagaaggtgcggtccctgctggagccgttgggcctccac
tgcaccttcatcgacgacttcaccccgtaccacatgctgcacggggaggtgcactgcggc
accaacgtgcgccggcagcccttctccttcaagtggtggaacatggtgccctga

DBGET integrated database retrieval system