KEGG   Felis catus (domestic cat): 101085917Help
Entry
101085917         CDS       T02385                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
fca  Felis catus (domestic cat)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101085917 (GRIK4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    101085917 (GRIK4)
Ion channels [BR:fca04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   101085917 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 765 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQSQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLERLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVADGLSMDSRLYASNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGMQERTSLFG
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcccgcgtggctcgtgatggtcgcctgc
agtccacactccttgaggatcgctgctatcttggatgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgccgtcctgggaccctcctccagt
ccggcctccagctctatcatcagcaacatctgtggggagaaggaggtcccccatttcaaa
gtggccccagaggaatttatcaagttccagtcccagagattcacaaccctgaacctccac
cccagcaacaccgacatcagcgtggctgtagctgggatcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctggagaggctgctgcgg
caattccttatctccaaggacacactctccgtccggatgctggatgacacccgggacccc
accccgctcctcaaggagatccgggacgacaagacagccaccatcatcatccatgccaac
gcctccatgtcccacaccatcctcctgaaggcagctgaactcgggatggtgtcggcctat
tacacatacatcttcactaatctggagttctcgctccagagaatggacagcctcgtggat
gatcgtgtcaacatcctgggattttccattttcaaccagtcgcatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgcgaccacgtgcccttcactggc
cctgcgctctcctcggccctgctgtttgacgccgtctatgctgtggtgactgcggtgcag
gagctgaaccggagccaggagatcggcgtgaagcccctgtcctgcggctcggcccagatc
tggcagcacggcacgagcctcatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacatcgaattcaacagcaaaggccagaggtccaactatgccttgaaaatcttacag
ttcaccaggaatggttttcggcagattggccagtggcacgtggctgatggcctcagcatg
gacagccgcctctatgcctccaacatctccgacagtctcttcaacaccaccctggttgtc
accaccatcctggaaaacccgtatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccgg
ttcaactacaagatccgcctggtcggggatggtgtgtacggtgttcctgaggccaatggc
acctggacgggaatggtcggggagctgatcgctaggaaagcagacctggccgtggcaggc
ctcaccattactgctgaacgggagaaggtgattgatttctccaagccattcatgactctg
ggaattagcattctttaccgagttcatatggggcgcaaacctggctatttctccttcctg
gacccattttctccaggcgtctggctcttcatgcttctagcctatctggccgtcagctgc
gtcctcttcctggtggctcggttgaccccctacgagtggtacagcccccacccctgtgcc
caaggccggtgcaacctcctggtgaatcagtactcccttggcaacagcctctggtttcct
gttgggggattcatgcagcaggggtccaccatcgccccccgagccttatccacccgctgt
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaaccta
gcagccttcctgactgtgcaacgcatggatgtgcccattgagtcagtggatgacctggct
gaccagaccgccattgagtatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctatcagacctaccagcgcatgtggaattacatgtattctaagcagccaagt
gtgtttgtgaagagcacggaggaggggatcgccagggtgttgaattccaactacgccttc
cttctggaatctaccatgaatgagtactaccggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggtatgcaggagagg
accagcctctttgggtag

DBGET integrated database retrieval system