KEGG   Felis catus (domestic cat): 101085917Help
Entry
101085917         CDS       T02385                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
fca  Felis catus (domestic cat)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:fca04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:fca04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 915 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQSQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLERLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVADGLSMDSRLYASNISDSLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVN
LQRGTTCSVSVCQEMVTXXXXXXXXXEAALVARGCTHIRVCPECRRFQGLRARPSPARSE
ESLEWEKTTNSSEPE
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcccgcgtggctcgtgatggtcgcctgc
agtccacactccttgaggatcgctgctatcttggatgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtacgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgccgtcctgggaccctcctccagt
ccggcctccagctctatcatcagcaacatctgtggggagaaggaggtcccccatttcaaa
gtggccccagaggaatttatcaagttccagtcccagagattcacaaccctgaacctccac
cccagcaacaccgacatcagcgtggctgtagctgggatcctgaacttcttcaactgcacc
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctggagaggctgctgcgg
caattccttatctccaaggacacactctccgtccggatgctggatgacacccgggacccc
accccgctcctcaaggagatccgggacgacaagacagccaccatcatcatccatgccaac
gcctccatgtcccacaccatcctcctgaaggcagctgaactcgggatggtgtcggcctat
tacacatacatcttcactaatctggagttctcgctccagagaatggacagcctcgtggat
gatcgtgtcaacatcctgggattttccattttcaaccagtcgcatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgcgaccacgtgcccttcactggc
cctgcgctctcctcggccctgctgtttgacgccgtctatgctgtggtgactgcggtgcag
gagctgaaccggagccaggagatcggcgtgaagcccctgtcctgcggctcggcccagatc
tggcagcacggcacgagcctcatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacatcgaattcaacagcaaaggccagaggtccaactatgccttgaaaatcttacag
ttcaccaggaatggttttcggcagattggccagtggcacgtggctgatggcctcagcatg
gacagccgcctctatgcctccaacatctccgacagtctcttcaacaccaccctggttgtc
accaccatcctggaaaacccgtatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccgg
ttcaactacaagatccgcctggtcggggatggtgtgtacggtgttcctgaggccaatggc
acctggacgggaatggtcggggagctgatcgctaggaaagcagacctggccgtggcaggc
ctcaccattactgctgaacgggagaaggtgattgatttctccaagccattcatgactctg
ggaattagcattctttaccgagttcatatggggcgcaaacctggctatttctccttcctg
gacccattttctccaggcgtctggctcttcatgcttctagcctatctggccgtcagctgc
gtcctcttcctggtggctcggttgaccccctacgagtggtacagcccccacccctgtgcc
caaggccggtgcaacctcctggtgaatcagtactcccttggcaacagcctctggtttcct
gttgggggattcatgcagcaggggtccaccatcgccccccgagccttatccacccgctgt
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaaccta
gcagccttcctgactgtgcaacgcatggatgtgcccattgagtcagtggatgacctggct
gaccagaccgccattgagtatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctatcagacctaccagcgcatgtggaattacatgtattctaagcagccaagt
gtgtttgtgaagagcacggaggaggggatcgccagggtgttgaattccaactacgccttc
cttctggaatctaccatgaatgagtactaccggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggttcggttttccgg
gatgagttcgacctggccattctccagttgcaggagaacaaccgcctagaaattctgaag
cgtaaatggtgggaaggcggcaagtgccccaaggaggaagatcacagagccaaaggactg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggctatgttggagtttttatggactctccgacactcggaagctactgaggtaaac
cttcaaaggggtacgacctgtagtgtgtccgtctgccaggagatggtgacnnnnnnnnnn
nnnnnnnnnnnnnnnnaggaggccgccctggtggcccgcggctgcacacacatccgcgtc
tgccccgagtgccgcaggttccagggcctgcgggcgcgtccgtcgcccgcccgcagcgag
gagagcctggagtgggaaaagaccaccaacagcagcgagcccgagtag

DBGET integrated database retrieval system