KEGG   Felis catus (domestic cat): 101086000Help
Entry
101086000         CDS       T02385                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 871 aa AA seqDB search
MDKILEAVVTSSYPASVKQGLVRRVLEAXXXXXXXXRCLGRFRCPAEGEEGAVEFLEQAQ
QVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHLPLELMDGVVRNLS
NDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFSILIEVSLAKIEKV
FSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPPMVASLVKEDSNSGTSCLEQL
AELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTSQKSELAGFYPRLM
AKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPLMTKLQWLFAFLEH
SQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGTRICQKLKQSSSPS
PPEEPPSPSPTSVEKMFGGKIVTRIRCLHCLNVSSREEAFTDLSLAFPPTDRCRRRRLGS
VMLPAEDVGVGDPPSPSQAQVPSRVGSRRQRKHCVTGDAPTAVLDIEGLGPQGPGGQISG
EEKVEREEEVEEEAREEERPREQEEEEEKEKEAVAEEEEKAEKEKEAETAKEKEEDGTGP
GSQRGAAGEGSRSVLDLVNYFLSPERLTAENRYYCEPCASLQDAEKAVELSQGPRYLILT
LLRFSFDLRSMRRRKILDDVSIPLLLRLPLAGGRGQAYDLCSVVVHSGVSSESGHYYCYA
REGAARPAPSLGAADRPEPENQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQRP
GEGPETEPSSPRGRAEPTLHKDLMEAISKDNILYLQEQEKEARSRAAYISALPASPHWGR
GFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaggcggtggtgacatcctcgtaccccgcgagtgtgaagcagggc
ctggtgcggcgcgtgctggaggcgnnnnnnnnnnnnnnnnnnnnnnngcgctgcctgggt
cgcttccgttgtccggccgagggcgaggagggcgccgtggagttcctggagcaggcccag
caggtgagcgggctcctggcgcagctgtggcgcgctcagcccgctgcaatcctgccctgc
ctgaaggagctgtttgccgtcatctcttgcacagaggaagagcctccgtctagcgccctg
gccagcgtggtccagcacctcccattggagctaatggatggtgtcgtccggaacctcagc
aatgatgacagtgtgacagactctcagatgctgacggccatcagcaggatgatcgactgg
gtgtcgtggcccctggggaagaacattgacaaatggatcattgcactgttgaagggcttg
gccgctgttaagaagttcagcatcttgattgaggtttcgctcgccaaaattgagaaggtt
ttctccaagcttctgtaccccattgtccggggagctgccttgtctgtcctcaagtacatg
ctcctgaccttccagcactcccatgaagccttccacctgctcctccctcacatccccccc
atggtggcctctctggtcaaggaggactccaactcggggaccagctgcctggagcagctg
gcggagctggtccattgcatggtcttccggtttccaggcttcccagatctgtatgagcct
gtcatggaggccattaaggacctccatgttcccaatgaggaccgcatcaagcagctgctg
gggcaagatgcctggacctcgcagaagagtgagctggctggtttctacccccggctcatg
gccaagtcagacacgggcaagattggtttaatcaatttgggaaacacatgctacgtgaac
agcattcttcaagccttattcatggcttctgacttcagacactgtgtgctcagattgaca
gagaacaactcacagcccttgatgaccaagctgcagtggctctttgccttcctggagcac
agccagaggcctgccatttctccagagaatttcctgtctgcatcctggacaccctggttc
agccctggcacccagcaggactgctctgagtacctgaagtacctgttggatcggctacat
gaggaggagaagacggggaccaggatctgccaaaagctcaagcagtccagctcgccctcc
ccaccggaggagccccccagcccaagtcccacctctgtggagaagatgttcggaggcaag
attgttactcggatacgctgcctccactgcctcaacgtctcctccagggaagaggccttc
acggacctctctctcgctttcccccccaccgaccgctgtcgccgccgccgcctgggctca
gtgatgctccctgcagaggacgttggggtcggggaccccccgtcaccatcccaagcccag
gttccaagcagggtgggttctcggaggcagaggaaacattgcgtcacgggggacgccccc
actgctgtcctggacattgaaggtctgggcccccagggacctggggggcagatcagtggg
gaagagaaggtggagagggaggaggaagtggaggaggaagctcgggaggaggagaggccc
cgagagcaggaggaggaggaagagaaagagaaggaggcggtggcagaggaggaagagaag
gctgagaaggagaaggaggcagagaccgcaaaggagaaggaagaggacggcacggggcca
gggagccagaggggcgccgccggggagggctcccggtccgtcctggacctggtcaactac
ttcctgtcccccgagcggctgacggcggagaaccgctactactgcgagccttgtgcctcg
ctgcaggacgccgagaaggcagtggagctgagccaggggccgcgctacctcatcctgacc
ctgctgcgcttctcctttgacttgcgctccatgcgccgccgcaagatcctggacgacgtc
tccatccccttgctgctccgcctgcctctggccgggggccgcggccaggcctacgacctc
tgcagtgttgtcgtgcactcgggagtgtcctcggagagcggccactactactgctatgcc
cgcgagggcgccgcccgcccggccccctctttgggtgctgcggacaggcccgagcccgag
aaccagtggtacctgttcaacgacactcgggtgtccttctcttccttcgagtccgtcagt
aatgtcacctccttcttccccaaggacacggcctacgtgctcttttaccggcagcggcct
ggggaggggcctgagaccgagccgagctctcccagaggtcgggcagagcccaccctccac
aaagacttgatggaggccatttccaaagacaacatcctttacctgcaggagcaggagaag
gaggcacggagcagggcggcctacatctctgcactcccagcatctccgcactgggggagg
ggcttcgatgaagacaaggatgaggacgaaggctctccgggaggctgcaatcctgcaggt
ggcaatggcggggacttccacagactggtcttctaa

DBGET integrated database retrieval system