KEGG   Felis catus (domestic cat): 101086000Help
Entry
101086000         CDS       T02385                                 

Gene name
USP35
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 35
  KO
K11854  ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101086000 (USP35)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101086000 (USP35)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101086000 (USP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 RR_TM4-6 RNA_polI_A34 RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 101086000
NCBI-ProteinID: XP_006936946
Ensembl: ENSFCAG00000007458
UniProt: M3W7R7
Position
D1
AA seq 1004 aa AA seqDB search
MDKILEAVVTSSYPASVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGAEELPRRV
GCQLLHVAGRHHPEVFAEFFSARRVLRLLQGGAGPPGARALACVQLGLQLLPEGPAADEV
FALLRREVLRTVCERPGPAVCAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLAKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPPMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSILQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFAFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RICQKLKQSSSPSPPEEPPSPSPTSVEKMFGGKIVTRIRCLHCLNVSSREEAFTDLSLAF
PPTDRCRRRRLGSVMLPAEDVGVGDPPSPSQAQVPSRVGSRRQRKHCVTGDAPTAVLDIE
GLGPQGPGGQISGEEKVEREEEVEEEAREEERPREQEEEEEKEKEAVAEEEEKAEKEKEA
ETAKEKEEDGTGPGSQRGAAGEGSRSVLDLVNYFLSPERLTAENRYYCEPCASLQDAEKA
VELSQGPRYLILTLLRFSFDLRSMRRRKILDDVSIPLLLRLPLAGGRGQAYDLCSVVVHS
GVSSESGHYYCYAREGAARPAPSLGAADRPEPENQWYLFNDTRVSFSSFESVSNVTSFFP
KDTAYVLFYRQRPGEGPETEPSSPRGRAEPTLHKDLMEAISKDNILYLQEQEKEARSRAA
YISALPASPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaggcggtggtgacatcctcgtaccccgcgagtgtgaagcagggc
ctggtgcggcgcgtgctggaggcggcgcggcagccgctggagcgggagcagtgcctggcg
ctgctggcgctgggcgcgcgcctctacgtgggcggcgcggaggagctgccgcgccgcgtg
ggctgccagctgctacacgtggccggtcgccaccacccggaagtcttcgccgagttcttc
agcgcccgccgcgtgcttcgcctgctgcagggtggcgccggcccgccgggcgcccgtgct
ctcgcctgcgtacagctcggcctgcagctgttacccgaggggcccgcggccgacgaggtg
tttgcgctgctccggcgggaggtgctgcgcaccgtgtgtgagcgcccggggcccgcggtc
tgcgcgcaagtcgcccggttactggcgaggcatccgcgctgcgtccccgacggcccgcac
cgcctgcttttctgccagcagctggtgcgctgcctgggtcgcttccgttgtccggccgag
ggcgaggagggcgccgtggagttcctggagcaggcccagcaggtgagcgggctcctggcg
cagctgtggcgcgctcagcccgctgcaatcctgccctgcctgaaggagctgtttgccgtc
atctcttgcacagaggaagagcctccgtctagcgccctggccagcgtggtccagcacctc
ccattggagctaatggatggtgtcgtccggaacctcagcaatgatgacagtgtgacagac
tctcagatgctgacggccatcagcaggatgatcgactgggtgtcgtggcccctggggaag
aacattgacaaatggatcattgcactgttgaagggcttggccgctgttaagaagttcagc
atcttgattgaggtttcgctcgccaaaattgagaaggttttctccaagcttctgtacccc
attgtccggggagctgccttgtctgtcctcaagtacatgctcctgaccttccagcactcc
catgaagccttccacctgctcctccctcacatcccccccatggtggcctctctggtcaag
gaggactccaactcggggaccagctgcctggagcagctggcggagctggtccattgcatg
gtcttccggtttccaggcttcccagatctgtatgagcctgtcatggaggccattaaggac
ctccatgttcccaatgaggaccgcatcaagcagctgctggggcaagatgcctggacctcg
cagaagagtgagctggctggtttctacccccggctcatggccaagtcagacacgggcaag
attggtttaatcaatttgggaaacacatgctacgtgaacagcattcttcaagccttattc
atggcttctgacttcagacactgtgtgctcagattgacagagaacaactcacagcccttg
atgaccaagctgcagtggctctttgccttcctggagcacagccagaggcctgccatttct
ccagagaatttcctgtctgcatcctggacaccctggttcagccctggcacccagcaggac
tgctctgagtacctgaagtacctgttggatcggctacatgaggaggagaagacggggacc
aggatctgccaaaagctcaagcagtccagctcgccctccccaccggaggagccccccagc
ccaagtcccacctctgtggagaagatgttcggaggcaagattgttactcggatacgctgc
ctccactgcctcaacgtctcctccagggaagaggccttcacggacctctctctcgctttc
ccccccaccgaccgctgtcgccgccgccgcctgggctcagtgatgctccctgcagaggac
gttggggtcggggaccccccgtcaccatcccaagcccaggttccaagcagggtgggttct
cggaggcagaggaaacattgcgtcacgggggacgcccccactgctgtcctggacattgaa
ggtctgggcccccagggacctggggggcagatcagtggggaagagaaggtggagagggag
gaggaagtggaggaggaagctcgggaggaggagaggccccgagagcaggaggaggaggaa
gagaaagagaaggaggcggtggcagaggaggaagagaaggctgagaaggagaaggaggca
gagaccgcaaaggagaaggaagaggacggcacggggccagggagccagaggggcgccgcc
ggggagggctcccggtccgtcctggacctggtcaactacttcctgtcccccgagcggctg
acggcggagaaccgctactactgcgagccttgtgcctcgctgcaggacgccgagaaggca
gtggagctgagccaggggccgcgctacctcatcctgaccctgctgcgcttctcctttgac
ttgcgctccatgcgccgccgcaagatcctggacgacgtctccatccccttgctgctccgc
ctgcctctggccgggggccgcggccaggcctacgacctctgcagtgttgtcgtgcactcg
ggagtgtcctcggagagcggccactactactgctatgcccgcgagggcgccgcccgcccg
gccccctctttgggtgctgcggacaggcccgagcccgagaaccagtggtacctgttcaac
gacactcgggtgtccttctcttccttcgagtccgtcagtaatgtcacctccttcttcccc
aaggacacggcctacgtgctcttttaccggcagcggcctggggaggggcctgagaccgag
ccgagctctcccagaggtcgggcagagcccaccctccacaaagacttgatggaggccatt
tccaaagacaacatcctttacctgcaggagcaggagaaggaggcacggagcagggcggcc
tacatctctgcactcccagcatctccgcactgggggaggggcttcgatgaagacaaggat
gaggacgaaggctctccgggaggctgcaatcctgcaggtggcaatggcggggacttccac
agactggtcttctaa

DBGET integrated database retrieval system